PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G233300.1.p
Common NameGLYMA_04G233300, LOC778114
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 298aa    MW: 32304 Da    PI: 8.8863
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G233300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-393998261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s
  Glyma.04G233300.1.p 39 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRS 98
                         7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-303597IPR003851Zinc finger, Dof-type
PfamPF027016.4E-344097IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2644397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDTAQWAQGI GVVKQPMEGS KPPPPPPPPM LERRARPQKD QALNCPRCNS TNTKFCYYNN  60
YSLSQPRYFC KTCRRYWTEG GSLRNVPVGG GSRKNKRSTP PAPPSAPAPT KKLSDLATPN  120
FPQSASQDPK IHQGQDLNLA YPPAEDYSTV SKFIEVPYST ELDKGTTGLH QNPTSSSTTT  180
SASSQLSAME LLKTGIAAAS SRGLNSFMPM YNSTHGFPLQ DFKPPHGLNF SLEGFENGYG  240
GLQGIQEGPT GGARILFPTV EDLKQQVPST NEFDQQNRSQ EGSAHGYWNG MLGGGSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.47660.0meristem| root| somatic embryo| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G233300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572710.0DQ857271.1 Glycine max Dof21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236777.10.0Dof21
RefseqXP_028229943.10.0dof zinc finger protein DOF4.6-like isoform X1
TrEMBLA0A445L4430.0A0A445L443_GLYSO; Dof zinc finger protein DOF4.6 isoform A
TrEMBLQ0GLD10.0Q0GLD1_SOYBN; Dof21
STRINGGLYMA04G41170.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-50Dof family protein