PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G230600.1.p
Common NameGLYMA_04G230600, LOC100803096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRF
Protein Properties Length: 594aa    MW: 63535.8 Da    PI: 8.1839
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G230600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.46.8e-25204247144
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Glyma.04G230600.1.p 204 DPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 247
                          79***************************************998 PP

2QLQ54.14.8e-19147179234
                  QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                          +FT aQ+ +L++Q+++yKy++a++PvPp+Ll +
  Glyma.04G230600.1.p 147 PFTSAQWRELERQAMIYKYMMASVPVPPDLLIP 179
                          8*****************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.6E-11146182IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.948147182IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-13147179IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.739204248IPR014977WRC domain
PfamPF088792.1E-20205247IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MGELFGVGKR RDIISNNNSA SSSVLGLDVK VQSPEVLFHN RMTMMGHHNH HLHPLSSPFD  60
NNNDISCAAG DGDGDGPTTY MSLTNHINLV SGASVLGPAI DGGCGAAPAA PVRTLQPFQI  120
SSYTSPTTTT TAFEPFSGVM AASLGFPFTS AQWRELERQA MIYKYMMASV PVPPDLLIPT  180
SLTSSSRSSC MDGGFNLRLA NSTDPEPGRC RRTDGKKWRC SRDVAPNHKY CERHMHRGRP  240
RSRKPVEVNT NTTPTSINNN NNNHQIKRAR HECNNPFATP DVAVAISNPT SRKGESSSHF  300
LGSTTTQPYL KSPLCLANFG LKAASFDSVA SVSANKEPRG LEWMLNGDPI SLDASNSQWQ  360
SLMHNKVGMS SVSSCNTTES QYLNSFALYS SGLEQQNRRH PLFLNPLLVP MKNLQPEKPR  420
GFIDAWSNAE TAQSNANTNN KNSAASIGKL SLSSLDLSMG GGAVSEDVDN VNMGLGLMET  480
YGKTHTDTKI SLSNWHNPAP WVASSSTLGG PLAEVLRSST VTATTNEATS NATSSPATTT  540
HAESNSPLGT MVSSPSGVLQ KTLISLSDSS NNSSPTVASS RANSEMAFLS FKF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G230600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578874.10.0growth-regulating factor 7 isoform X1
RefseqXP_028229898.10.0growth-regulating factor 7-like isoform X1
TrEMBLK7KLU30.0K7KLU3_SOYBN; Uncharacterized protein
STRINGGLYMA04G40880.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Representative plantOGRP1109257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.19e-36growth-regulating factor 7