PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G216100.1.p
Common NameGLYMA_04G216100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 501aa    MW: 56930.4 Da    PI: 6.6177
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G216100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.44.5e-2942127187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+++e++aL+++r+em+ ++++++lk+plWe+vs+k++e g++rs+k+Ckek+en+ k+++++keg+ ++ s+  +t+++f+qlea
  Glyma.04G216100.1.p  42 RWPREETMALLNIRSEMDVAFKDANLKAPLWEQVSRKLSELGYNRSAKKCKEKFENIYKYHRRTKEGRFGK-SNGAKTYRFFEQLEA 127
                          8********************************************************************97.67778********85 PP

2trihelix93.32.5e-29328420187
             trihelix   1 rWtkqevlaLiearremeerlrrgk.......lkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfd 83 
                          rW+k+ev aLi++r++++ + + ++       +k+plWee+s++m++ g+ rs+k+Ckekwen+nk++k+ike +k++ +++s+tcpy++
  Glyma.04G216100.1.p 328 RWPKDEVEALIRLRTQIDVQAQWNSnnnnnngSKGPLWEEISSAMKSLGYDRSAKRCKEKWENINKYFKRIKEKSKRK-PQDSKTCPYYH 416
                          8**************88877774322345566********************************************86.9********** PP

             trihelix  84 qlea 87 
                          +lea
  Glyma.04G216100.1.p 417 HLEA 420
                          *985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.5263599IPR017877Myb-like domain
SMARTSM007170.001939101IPR001005SANT/Myb domain
CDDcd122033.87E-2141106No hitNo description
PfamPF138373.2E-1941128No hitNo description
SMARTSM007171.6E-4325394IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-4326391IPR009057Homeodomain-like
PfamPF138378.6E-21327421No hitNo description
PROSITE profilePS500907.433327392IPR017877Myb-like domain
CDDcd122032.62E-21327399No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MLEISTSQET PLENADGGSA AVSDGSKAEH GEDDDRNPAA NRWPREETMA LLNIRSEMDV  60
AFKDANLKAP LWEQVSRKLS ELGYNRSAKK CKEKFENIYK YHRRTKEGRF GKSNGAKTYR  120
FFEQLEALDG NHSLLPPTTT DNNNNNNNVG DDVVLNAVPC SVSAAAHEHS SSTTSCSGKK  180
KRKLTQFLEG LMREVIEKQE TLQRKFVEVL DKCEKDRMAR EEAWKKEELE RIKKERELLA  240
QERSIAAAKD EAVLAFLRKF AEAEDTVQLL EKIQVQNDKQ KNMKQNGGND NANGGGGVAV  300
VTDMDKQECG NTNVRVSVGN FVHMSSSRWP KDEVEALIRL RTQIDVQAQW NSNNNNNNGS  360
KGPLWEEISS AMKSLGYDRS AKRCKEKWEN INKYFKRIKE KSKRKPQDSK TCPYYHHLEA  420
LYSKKPKKVD LGNELKPEEL LMHIMVSQSQ EQQQQQEMQT QTQSPSEDAE RDQNQGDNED  480
QSEYQNQMVD NNSPSIAIMS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178183KKKRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.370990.0cotyledon| seed coat| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G216100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2217530.0EF221753.1 Glycine max trihelix transcription factor (GT-2A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236630.10.0trihelix transcription factor
SwissprotQ391173e-63TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLK7KLJ40.0K7KLJ4_SOYBN; Uncharacterized protein
STRINGGLYMA04G39400.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-55Trihelix family protein