PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G197100.1.p
Common NameGLYMA_04G197100, LOC100787407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 372aa    MW: 40728.3 Da    PI: 8.689
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G197100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-4073149278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C v+gC++dls++++yhrrhkvCe hsk+p+v++ g +qrfCqqCsrfh+l++fDe+krsCr+rL++hn+rrrk+q+
  Glyma.04G197100.1.p  73 CLVDGCNSDLSNCRDYHRRHKVCELHSKTPEVTIGGFKQRFCQQCSRFHSLEQFDERKRSCRKRLDGHNRRRRKPQP 149
                          **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-3169134IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.5370147IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3871152IPR004333Transcription factor, SBP-box
PfamPF031105.4E-3073146IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MEEQNRFGVY RMKGEFSVDL KLGHHVGNSG TESALANKSK DAAAAGVSKM ASSPSGSSKR  60
ARAINSTSLT VACLVDGCNS DLSNCRDYHR RHKVCELHSK TPEVTIGGFK QRFCQQCSRF  120
HSLEQFDERK RSCRKRLDGH NRRRRKPQPE PLSRPGSFLS NYQGTQLLPF SSPHVYPSTA  180
IVSPAWSASL VTSSADARLH NHNQQQHHHH QQDLFLGSSH KEGKQVAFLH NNHPSTAAAL  240
SSQTPPPFPS SSVRHTLLRT DPLSETCGGA RSKMFCESLT TTTTNNNSVH DTTPCALSLL  300
SSSQTHTPGN GLNQMVQPPP SMSLMQPLGL SLQDNNSLES VDHCSSMYSL ASDHGSQCNE  360
AAPQLFPFQW E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-27731461184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128145RKRSCRKRLDGHNRRRRK
2128146RKRSCRKRLDGHNRRRRKP
3129146KRSCRKRLDGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G197100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-119AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578709.10.0squamosa promoter-binding-like protein 13A isoform X2
TrEMBLK7KL730.0K7KL73_SOYBN; Uncharacterized protein
STRINGGLYMA04G37391.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-66SBP family protein