PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G169000.1.p
Common NameGLYMA_04G169000, LOC100782238
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 275aa    MW: 32085.1 Da    PI: 5.4731
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G169000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.71.5e-25141190352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          k +s +++s+yF++pi +AA+eL+v+lT LK++CR++GI+RWPhRk+ sl
  Glyma.04G169000.1.p 141 KMLSRKTVSQYFYMPISQAARELNVGLTHLKKRCRELGIQRWPHRKLLSL 190
                          78999*****************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.325123210IPR003035RWP-RK domain
PfamPF020426.5E-21143190IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MENQQLTFWK SNYEIDDYPF APTCQFSSYD YCSWGNANDG YHWPYEFPLQ DSYLDAIPYM  60
KCYYPHDILY ESTLPIEPTS LSIRDYDFSD VKNVLSALNE TDGSDHKPAF SSCNDGESVD  120
EMQEDLKGKK CREEGISSSA KMLSRKTVSQ YFYMPISQAA RELNVGLTHL KKRCRELGIQ  180
RWPHRKLLSL QTLIKNIQEQ RETGGHENDE KTRAAIEILE REQRKVEEMP DLELEDNTRR  240
LRQACFKANY KKRKLMGMRL IEPDSSLSGL FNKY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G169000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150352e-43AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578571.10.0protein RKD1
RefseqXP_028229082.10.0protein RKD1-like
TrEMBLA0A445L1A50.0A0A445L1A5_GLYSO; Protein RKD1 isoform A
STRINGGLYMA06G20881.11e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-55RWP-RK domain-containing protein