PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G159600.2.p
Common NameGLYMA_04G159600, LOC100777766
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 565aa    MW: 61271.2 Da    PI: 6.3907
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G159600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.71.3e-41184259277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          C v gC++dls +k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Glyma.04G159600.2.p 184 CLVYGCNKDLSGCKDYHKRHKVCEVHSKTSKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 259
                          9*************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-32176245IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.017181258IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-38182262IPR004333Transcription factor, SBP-box
PfamPF031101.3E-30184257IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MESWSYVAEE KGYVSSEALS PPNTLERSKG SCFGWELKTP CSFSNDMLGL GQQNVEDQGF  60
GELGFPGMLG KQLCGDDPNP IGAVQSRKVD DVVVDCRITS PSPVVAAPNG FSSREDFNSK  120
LSNALVDSNG GNSLIDLKLG WFADHGDAMV PTFSKGAPIL SSSELSTPPK RVRASGAHSQ  180
TAYCLVYGCN KDLSGCKDYH KRHKVCEVHS KTSKVIVNGI EQRFCQQCSR FHLLAEFDDG  240
KRSCRKRLAG HNERRRKPQV GIHSGKAGRL LQPYADSRFQ ETMLTSSFIC QEILPSGVLS  300
SEKYGASDMW RPIKAEDSTG FTFRPLSSIP ITNGHPQSRS LFPSYSGKQL PFLHENGATS  360
ATGNIFSENN NQYNPPSLGG QSSGSQSLFQ DSSLGREDFN VFDTESAVQG LSGISDSGCA  420
LSLLSSQSQN SSGQSSGIPI AHPMVIPSSH SHYNMSRVSE KMIGISSQAS SGVSDRFPPE  480
FNPVDGSHLS PILISDNNEI INFEMANGIF QGSDFVNVKD RLSCEDSLTI DLLQLSSQLQ  540
RVENQRLSLQ VKQENDSSCS LRIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-281842571184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.186580.0root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G159600.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578521.10.0squamosa promoter-binding-like protein 16
RefseqXP_014630196.10.0squamosa promoter-binding-like protein 16
RefseqXP_014630197.10.0squamosa promoter-binding-like protein 16
RefseqXP_028228978.10.0squamosa promoter-binding-like protein 16
RefseqXP_028228980.10.0squamosa promoter-binding-like protein 16
TrEMBLA0A0B2PJL30.0A0A0B2PJL3_GLYSO; Squamosa promoter-binding-like protein 6
TrEMBLK7KKE60.0K7KKE6_SOYBN; Uncharacterized protein
STRINGGLYMA04G32002.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-51SBP family protein