PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G158800.1.p
Common NameGLYMA_04G158800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 342aa    MW: 37305.6 Da    PI: 7.7497
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G158800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-383190362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +  +kcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+s+
  Glyma.04G158800.1.p 31 QPPIKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSN 90
                         6679****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.1E-333388IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-263488IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5713488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MQEIHSIGGG RFFGGGGDRR LRPHHQNHHQ QPPIKCPRCD SLNTKFCYYN NYNLSQPRHF  60
CKNCRRYWTK GGVLRNVPVG GGCRKSKRSN KPKTTTSAAA TTSSNNNNNN PSSSSETAAA  120
TAPTPPQQPP PPLELEHNSH SHSSSESSTY TVAATEAMSA PTTNAVSNNN LLLDNNRESK  180
MFANPNPYLE QSRSGGLFSD IESFSSLVNL NNQALGFGFG NNNSNISILD ATSFRFGVSV  240
TNPHGNDQVL AAPGGGHGQW QQQQQNHHEF GTASFLDHTV PLEFSSLQHK AGHQGGFGPL  300
DWQPGGDQGL FDLPNTVDQP YWTHHTHWSD QDNPSSLFHL P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1816GGRFFGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.258070.0cotyledon| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G158800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572730.0DQ857273.1 Glycine max Dof22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236806.20.0Dof22
RefseqXP_028228972.10.0dof zinc finger protein DOF5.4-like
TrEMBLA0A445L0X00.0A0A445L0X0_GLYSO; Dof zinc finger protein DOF5.4
TrEMBLI1JWL70.0I1JWL7_SOYBN; Uncharacterized protein
STRINGGLYMA04G31690.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-34OBF binding protein 4