PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G151000.1.p
Common NameGLYMA_04G151000, LOC100815048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 463aa    MW: 51005.8 Da    PI: 7.4466
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G151000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-32252307156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Glyma.04G151000.1.p 252 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 307
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355249309IPR017930Myb domain
SuperFamilySSF466895.38E-17249310IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28250310IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26252307IPR006447Myb domain, plants
PfamPF002498.1E-7254305IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MSSQVELSMD YKPYSYSTLL KSYADETETD QTHKLEEFLS RLEEERVKID AFKRELPLCM  60
QLLTNAVEAS RQQLQAFRSN QGTRPVREEF MPIKHPNSQE STEKTSNISD KANWMTSAQL  120
WSQASEGTKP QSTITSPKNG ADMGFSVSPN PALDNKHRNG GAFLPFSKER NSCQGLRDLP  180
EVALASSEKE MEKKCELESE KCSKRENSGK GSGSCEGVVD QGKSASVASE AQTTNTTITT  240
TTNNTTGQTH RKARRCWSPD LHRRFVNALQ MLGGSQVATP KQIRELMKVD GLTNDEVKSH  300
LQKYRLHTRR PSPSLQTGAP TPQLVVFGGI WVPPEYARAA AHSGGPTLCG PHPTSHVPPP  360
HYCAPTPMPQ EFYNSAPSLS LPSPAHENIL HHHHFHMYKT APQTRSSPVS DVRSGGDRSE  420
TIEDGKSESG SWKAENGEKK GLAALRDQEG DESTGSEITL KF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-14252305154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-14252305154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-14252305154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-14252305154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed 3 days after germination, with a gradual decrease before the floral transition and remains at low levels afterward. {ECO:0000269|PubMed:25132385}.
UniprotTISSUE SPECIFICITY: Specifically expressed in vascular tissues of cotyledons, rosette leaves and cauline leaves. Not detected in the vegetative shoot apical meristem. {ECO:0000269|PubMed:25132385}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G151000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524007.10.0myb family transcription factor EFM
SwissprotQ9ZQ851e-123EFM_ARATH; Myb family transcription factor EFM
TrEMBLI1JW880.0I1JW88_SOYBN; Uncharacterized protein
STRINGGLYMA04G21680.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-110G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]