PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G150500.1.p
Common NameGLYMA_04G150500, LOC100805968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 504aa    MW: 56008.3 Da    PI: 4.7869
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G150500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS413.61.8e-1261244881373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                          lv++L++cA+ v++gdl  a +l+++++ l a  +    + ++a yf  AL++r++ ++  l +   +s       +e    ++ ++e++
  Glyma.04G150500.1.p 124 LVHTLMTCADSVQHGDLPFAGSLIENMQGLlAHVNTnIGIGKVAGYFIDALRRRIFAQGVFLTS---CSY-----PIEDDVLYHHYYEAC 205
                          689*************************995333332699****************93333322...222.....3444467789***** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          P+lkf+h+taNqaIlea++g+++vH+iDf+++qGlQWpaL+qaLa Rp+gpp lR+Tg+g p+s+++++l+e+g rLa++A++++v+f f
  Glyma.04G150500.1.p 206 PYLKFAHFTANQAILEAFNGHDCVHVIDFNLMQGLQWPALIQALALRPGGPPLLRLTGIGLPSSDNRDTLREIGLRLAELARSVNVRFAF 295
                          ****************************************************************************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          + ++a rled+++++L+v+p+Ea+aVn+++qlhrll+++ + +   +++vL  ++sl+Pk++ vveqea+hn+  Flerf+eal+yys++
  Glyma.04G150500.1.p 296 RGVAAWRLEDVKPWMLQVNPNEAVAVNSIMQLHRLLASDSDPAGsGIETVLGWIRSLNPKIISVVEQEANHNEDMFLERFTEALHYYSTV 385
                          **9888*****************************987765544499******************************************* PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fdslea      e ++ + +++l+rei+nvv+ceg +r+erhe l kWr+rl++aGFkp++l+++a+kqa++ll  ++ +gy vee++g+
  Glyma.04G150500.1.p 386 FDSLEAC---PVEPDKALAEMYLQREICNVVCCEGPARVERHEPLDKWRKRLGKAGFKPLHLGSNAYKQASMLLTLFSAEGYCVEENQGC 472
                          ****999...467777888999******************************************************************** PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l+lgW++rpL+++SaW
  Glyma.04G150500.1.p 473 LTLGWHSRPLIAASAW 488
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011295.6E-121995No hitNo description
PfamPF120411.3E-291989IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098562.77698469IPR005202Transcription factor GRAS
PfamPF035146.2E-124124488IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MASSSSNGSS SGSKSWDIDG DLAGFGYKVR SSELQHVAEN MERLENVMDI VNSSTNNNIS  60
QLASDTIFYN PSDIGSWIDT LLSEFDQTAS LPYDFSELPD LDTDQIQNLK PTLVTMEEDS  120
GIRLVHTLMT CADSVQHGDL PFAGSLIENM QGLLAHVNTN IGIGKVAGYF IDALRRRIFA  180
QGVFLTSCSY PIEDDVLYHH YYEACPYLKF AHFTANQAIL EAFNGHDCVH VIDFNLMQGL  240
QWPALIQALA LRPGGPPLLR LTGIGLPSSD NRDTLREIGL RLAELARSVN VRFAFRGVAA  300
WRLEDVKPWM LQVNPNEAVA VNSIMQLHRL LASDSDPAGS GIETVLGWIR SLNPKIISVV  360
EQEANHNEDM FLERFTEALH YYSTVFDSLE ACPVEPDKAL AEMYLQREIC NVVCCEGPAR  420
VERHEPLDKW RKRLGKAGFK PLHLGSNAYK QASMLLTLFS AEGYCVEENQ GCLTLGWHSR  480
PLIAASAWHA APVQDRETLR FEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4816548942375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.254600.0seed coat| somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524001.10.0PREDICTED: DELLA protein DWARF8-like
SwissprotQ84TQ71e-164GAI_GOSHI; DELLA protein GAI
TrEMBLI1JW830.0I1JW83_SOYBN; Uncharacterized protein
STRINGGLYMA04G21340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-143GRAS family protein