PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G062500.1.p
Common NameGLYMA_04G062500, LOC100793913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 657aa    MW: 72493.5 Da    PI: 6.8476
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G062500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.62.8e-28204257155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ +LH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Glyma.04G062500.1.p 204 KPRVVWSVDLHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 257
                          79*******************.********************************8 PP

2Response_reg79.51.1e-26201281109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+p+ + +l+++l++ +y +v+++ ++ +al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ +
  Glyma.04G062500.1.p  20 VLAVDDDPTCLLVLKTLLQRCQY-HVTTTNQAIKALALLREHKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKMVMK 107
                          799********************.***************999889*******************87754.558***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           ++ Ga d+l Kp+ +eel +
  Glyma.04G062500.1.p 108 GISHGACDYLLKPVRMEELKN 128
                          ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.7E-1661656IPR017053Response regulator B-type, plant
SuperFamilySSF521728.54E-3717141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.3E-4317152No hitNo description
SMARTSM004482.7E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.07419134IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.5E-2420128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.35E-2821134No hitNo description
Gene3DG3DSA:1.10.10.603.2E-30201262IPR009057Homeodomain-like
PROSITE profilePS5129411.368201260IPR017930Myb domain
SuperFamilySSF466893.05E-19202261IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-25204257IPR006447Myb domain, plants
PfamPF002493.9E-6206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MTVEKKRNDS GDEFPVGMRV LAVDDDPTCL LVLKTLLQRC QYHVTTTNQA IKALALLREH  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKMVMKGIS HGACDYLLKP  120
VRMEELKNIW QHVIRRKKFD SKEKNKTSNL DKPTSNSGNG LGSSGTGNSD QNEKLTKKRK  180
DQDEDEDEDQ ENDLDNEDPS AQKKPRVVWS VDLHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQKYRLYLK RISCVANQQA NMVAALGVAD PSYLRMSSVS GVGHVQTLSG  300
SGQLHNNNFR SFPPSGIINR LNTPAGLNVH GFPSGVLQLS QSQNLNNAND HHKFQSVIVP  360
VNQNGVQGMT VSVGLDQLQN NKVVMSVQNL TTVFDAKTTF PIPNKLPDPR PKITNSVSHT  420
SDVHFSNNAL MLEPRPQGSQ GSVRIGTLSS SVASQHSEFS LSLLDQGRYS DNWTSAVQPS  480
VIQTNFFPPS ECFRQTNIPP ADNMASVPLQ GGNLSGPSIT SLSRQSHDSM TEMHSEGMTF  540
TNRPGHTSSN VPFQGWDDHN QDATHHSNIM SINSLTPVNG AAVQAGHAAT NSVLHRNLDF  600
NYCDPLQMKH EGFVELTDET LLKQHQGNTM DQQKSQENHF SNNLGSLEDL VSSMMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-25200263164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.380950.0somatic embryo
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G062500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0938360.0BT093836.1 Soybean clone JCVI-FLGm-24O12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014629984.10.0two-component response regulator ARR12 isoform X1
RefseqXP_028227940.10.0two-component response regulator ARR12-like isoform X1
SwissprotB8AEH11e-143ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A445KWD90.0A0A445KWD9_GLYSO; Two-component response regulator
TrEMBLI1JU860.0I1JU86_SOYBN; Two-component response regulator
STRINGGLYMA04G06650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-125response regulator 12