PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G049300.1.p
Common NameGLYMA_04G049300, LOC100790927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 291aa    MW: 33159.2 Da    PI: 8.5554
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G049300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.8e-19135189256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +k+ ++tkeq  +Le+ F+++ ++s ++++eLAkkl+L +rqV vWFqNrRa+ k
  Glyma.04G049300.1.p 135 KKKLRLTKEQSAVLEDSFKEHYTISPKQKQELAKKLNLRTRQVEVWFQNRRARTK 189
                          78889************************************************98 PP

2HD-ZIP_I/II111.84.5e-36135223189
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                          +kk+rl+keq+++LE+sF+e+ +++p++K+ela++L+l++rqv+vWFqnrRARtk+kq+E++ e Lk+++++l+een++Leke +eL++
  Glyma.04G049300.1.p 135 KKKLRLTKEQSAVLEDSFKEHYTISPKQKQELAKKLNLRTRQVEVWFQNRRARTKLKQTEVERELLKKCCETLTEENKMLEKELQELKS 223
                          59*************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.35E-18128192IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-18129185IPR009057Homeodomain-like
PROSITE profilePS5007117.572131191IPR001356Homeobox domain
SMARTSM003893.2E-17133195IPR001356Homeobox domain
CDDcd000862.54E-16134192No hitNo description
PfamPF000466.3E-17135189IPR001356Homeobox domain
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
SMARTSM003403.5E-15191235IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGFDISKPGL RLGLGLGLHD DHSSENCMKT NEQSQRQRQS QKKKETDPCN KAYPSLKLGP  60
PDDEANNNNQ QITNIESDEY YYFHPHASSR SPSAVSSFSN SSSIIKRERE QLELEVEKIS  120
LSRDFVDVDE NGNPKKKLRL TKEQSAVLED SFKEHYTISP KQKQELAKKL NLRTRQVEVW  180
FQNRRARTKL KQTEVERELL KKCCETLTEE NKMLEKELQE LKSTKTSMGP FYMQLPVESL  240
RICPSCERIS GGNNGSSPTT ALLEAPKAHK DQPFYKNNYT FTQSSAAFAS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183191RRARTKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G049300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523637.10.0homeobox-leucine zipper protein HOX15
SwissprotA2XE761e-56HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-56HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLK7KI540.0K7KI54_SOYBN; Uncharacterized protein
STRINGGLYMA04G05200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-57homeobox from Arabidopsis thaliana