PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G261800.1.p
Common NameGLYMA_03G261800, LCL2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 749aa    MW: 82084.2 Da    PI: 6.1436
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G261800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-162468147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Glyma.03G261800.1.p 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.1731973IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-82171IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
PfamPF002493.1E-132467IPR001005SANT/Myb domain
CDDcd001671.44E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MDADSSGEEV VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAFVKG VPIGQALDID IPPPRPKRKP SNPYPRKTNV GAPTLHSEAK  120
HGKSLISIAS SHGKQALDLE KEPLPEKHNV DLRPTTVKEN KDGSCLNVFT IIQEAPCSSV  180
SSANKNSTSI SVPLRNSCAL REFIPSVKEV ITRDETNESF VTDELENQKL EIDDGKHTQK  240
TNDTCEVSKL ENSGASELVQ TEKTDGRNCA LTIDGVPGNQ NYPRHVPVHV VDGNLGTSTQ  300
NLSPDMVFQD SIFQPKGGVN RQPNLVTNSA TSHISECQNN AARSSIHQSF PPSPPFAQDD  360
YHSFLHMSST FSSLIVSTLL QNPAAHAAAS FAATFWPYAN AETSADSPVC TPDFPSRQIG  420
SPPSVTAIAA ATVAAATAWW AAHGLLPLCG PLHTAFACPP ASATTVPSMI IDESPQKTER  480
GEIKPQNPPL QDQIPDPEHS EAQHSAPKSP AVSSSKSEDR GDANLDTSPK ATNHEMNQAI  540
SENPDSNKMK GRKPVDRSSC GSNTTSSSEE TELLEKDEKE KEEPKTPDAN VLDTELSNRR  600
SRSISNLTDS WKEVSEEGRL AFQALFSREV LPQSFSPTHH LINKDNQIDS IKDNELNTDY  660
KDEDLESKKC SSICDGVQKN LLFVKDNNEE EGLLTIGLGP GKLKTRRTGF KPYKRCSVEA  720
NENRIGTACI QGEEKGPKRL RLNGEAST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.170380.0cotyledon| flower| leaf| pod| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.03G261800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0764340.0EU076434.1 Glycine max late elongated hypocotyl and circadian clock associated-1-like protein 2 (LCL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236400.10.0MYB transcription factor MYB114
RefseqXP_025983483.10.0MYB transcription factor MYB114 isoform X1
RefseqXP_028226910.10.0protein LHY-like
RefseqXP_028226911.10.0protein LHY-like
RefseqXP_028226912.10.0protein LHY-like
RefseqXP_028226913.10.0protein LHY-like
TrEMBLC0SNP20.0C0SNP2_SOYBN; Late elongated hypocotyl and circadian clock associated-1-like protein 2
STRINGGLYMA03G42260.60.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Representative plantOGRP9903510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.12e-81circadian clock associated 1
Publications ? help Back to Top
  1. Liu H, et al.
    Analysis of clock gene homologs using unifoliolates as target organs in soybean (Glycine max).
    J. Plant Physiol., 2009. 166(3): p. 278-89
    [PMID:18707796]