PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G258800.1.p
Common NameGLYMA_03G258800, LOC100775598
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 294aa    MW: 32654.6 Da    PI: 9.3882
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G258800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-3956116262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++l+cprC stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+++
  Glyma.03G258800.1.p  56 PQEQLNCPRCSSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRVT 116
                          6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2751114IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3358114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.03160114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MHGYYRSLGK HGVRFFSLVF SLMHKFRAVH SELVRSMEDI GPNSCTRPVT EKKARPQEQL  60
NCPRCSSTNT KFCYYNNYSL TQPRYFCKTC RRYWTEGGSL RNVPVGGGSR KNKRVTSSKV  120
PDLNPPISLS SVSAISSQNP KMQGVHDLNL AFPAAMDKYH HGTSPYVEMP KLEIGGDHST  180
SHHSHHHSHS PSSAVELLRS GMDSRGLNPY APNSLMSGSD HSLYTPGYPM QEIKPNLSFS  240
VDDGFGNRSY GVQENGGGRL LFPFGDIKHL SAGLEVEHNK EQGNNSTGYW TGW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.226870.0hypocotyl| leaf| meristem| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotTISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
UniprotTISSUE SPECIFICITY: Expressed in the vascular system of the mother plant, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the activation of a component that would trigger germination as a consequence of red light perception.
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.03G258800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572680.0DQ857268.1 Glycine max Dof18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520878.10.0dof zinc finger protein DOF2.5 isoform X1
RefseqXP_028226874.10.0dof zinc finger protein DOF2.5-like isoform X1
SwissprotQ433852e-58DOF37_ARATH; Dof zinc finger protein DOF3.7
SwissprotQ9ZPY02e-57DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLK7KH420.0K7KH42_SOYBN; Uncharacterized protein
STRINGGLYMA03G41980.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.42e-65Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]