PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G219900.1.p
Common NameGLYMA_03G219900, LOC100791952
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 541aa    MW: 61835.1 Da    PI: 6.4035
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G219900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS253.67.2e-781705382374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsevs 88 
                           + Ll++Ae v  +++e+a+ lL + +  +s +++p+qR++++f++AL++r+++++ ++  + + ++++++    +++++++    +   
  Glyma.03G219900.1.p 170 AQFLLAAAERVGCQQFERANGLLLHCEWSSSGSASPVQRVIFHFARALRERIYKETGRMTVKGSGKNEERELiqkMDTNISIK--CHLKI 257
                          678***************************************************66555544444444433333233333333..44457 PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                          P+ ++ +++  qaI+e v++e+++H iD++i  G+Q  aL+qaL++R+      l+iT++g ++   k ++eetg+ L++fAe+l++pf+
  Glyma.03G219900.1.p 258 PFNQVMQFAGVQAIVEHVASETKIHLIDLEIRSGVQCTALMQALSERRdCIVQLLKITAIGLNS--LKIKIEETGKSLTSFAESLNLPFS 345
                          *********************************************999345669********55..99********************** PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          +n++ + ++++++ +++++ ++Ea+aV + + l ++++++ ++e+    +++++++++P +++v e ea+hns+s+++rf+eal +ysa 
  Glyma.03G219900.1.p 346 YNAVFVADIAEIRKDHFEIGEDEAVAVYSPYFLRSMVSRPDCMEN----LMRIIRNIKPVIMIVLEVEANHNSPSLVNRFIEALFFYSAY 431
                          ************************************988888888....***************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                          fd+le+ + +e e ++++E++ l++ i+++va+eg+er+ r+ +   Wr+ + +  + +  +se+    a+l+ + ++ ++  ++e++ +
  Glyma.03G219900.1.p 432 FDCLETCIKHEIECKMTIEAV-LSEGIRDIVAMEGRERTVRNVKIDVWRRFFARYRMVETGFSESSLYHAHLVAKGFAfGKFCTIEKNGK 520
                          **********99*******99.********************************************************878789999999 PP

                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                           lv gWk+ p+ s+SaWr
  Glyma.03G219900.1.p 521 GLVVGWKGTPMHSISAWR 538
                          *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.091143517IPR005202Transcription factor GRAS
PfamPF035142.5E-75170538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MEFLGEIDPL PTEDGKGAKL FNDQDQKQLQ EPKIDNFMLE EVNFNPDMQM QPTQLFQETT  60
GLMKHVRVNS ELVEYNKQVP PTPSLASLEL LRNYGSRFKR LSEQNISTLS NIETSFDRQK  120
MSTEEIIRVA GARYLQYSAH WNDSFYIPMH PYGLDLVGFS EEENRDIELA QFLLAAAERV  180
GCQQFERANG LLLHCEWSSS GSASPVQRVI FHFARALRER IYKETGRMTV KGSGKNEERE  240
LIQKMDTNIS IKCHLKIPFN QVMQFAGVQA IVEHVASETK IHLIDLEIRS GVQCTALMQA  300
LSERRDCIVQ LLKITAIGLN SLKIKIEETG KSLTSFAESL NLPFSYNAVF VADIAEIRKD  360
HFEIGEDEAV AVYSPYFLRS MVSRPDCMEN LMRIIRNIKP VIMIVLEVEA NHNSPSLVNR  420
FIEALFFYSA YFDCLETCIK HEIECKMTIE AVLSEGIRDI VAMEGRERTV RNVKIDVWRR  480
FFARYRMVET GFSESSLYHA HLVAKGFAFG KFCTIEKNGK GLVVGWKGTP MHSISAWRFL  540
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-2519853832375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520753.30.0PREDICTED: DELLA protein RGL1-like isoform X1
TrEMBLK7KGE20.0K7KGE2_SOYBN; Uncharacterized protein
STRINGGLYMA03G37851.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.15e-46RGA-like protein 3