PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G211500.1.p
Common NameGLYMA_03G211500, LOC100780237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HB-other
Protein Properties Length: 1025aa    MW: 113880 Da    PI: 9.5063
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G211500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.44.3e-0769125157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +r+R  ++++ ++ ++++F  +  +s++e +e+++ lg+t +qV+ +F  +R + ++
  Glyma.03G211500.1.p  69 KRPRDLLNPKAVNYMQSVFSIKDAISKKELREISALLGVTVTQVRDFFNAQRSRVRR 125
                          799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.20366126IPR001356Homeobox domain
SMARTSM003892.3E-668130IPR001356Homeobox domain
SuperFamilySSF466898.55E-768132IPR009057Homeodomain-like
PfamPF000461.4E-469125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.4E-669135IPR009057Homeodomain-like
CDDcd000866.46E-669126No hitNo description
Gene3DG3DSA:1.20.930.101.6E-4225310IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1025 aa     Download sequence    Send to blast
MDAWNEDFSE LEIGSSTESF QKFLVSQREL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSVFSIK DAISKKELRE ISALLGVTVT QVRDFFNAQR  120
SRVRRSVQLS RERALSSNSC EEPHDDQINS DPMRPINPTP LNSAGLSNTE EASCSTQEVT  180
LSDLDDSDKQ FVDSIFSLMQ KEETFSGQEK LMEWILTIQN FSVLLWFLSR GGGMNLATWL  240
SKAAVEEQTS VLLLVLKVLC HLPLHKAVPM HISAILQSVN KLRFYRTSDI SNRARVLLSK  300
WSKLFARNHV IKKPNGVKTS SDGHKEMMLS RSIGQLMGSE SWHSNIDVPE DILALSSECS  360
NNFRKIGSPQ GVKLLPPSLD NSNKKSTLGV SSSQSRERRK VQLVEQPGQK SVSRSSQVTR  420
AGPVSQGRPM SADDIQKAKM RALFMQSKYG KSGSKESSET KIDSPYKQPQ TNPASIAACS  480
SKVPTPPKIE ENEKPLLLAS KATNKLEASY SKPKMDVKEP LWEKCKRVQI PWKTPAEVEL  540
KDTWRVGGGE NSKEVEVQRN RNRRDKEIIY KTVQEMPPNP KEPWDLEMDY DDTLTLEIPI  600
EQLPDGDADI AISPNHVATH SVQGVASTSS TSVATAEPDL ELLAVLLKNP ELVFALTSGQ  660
GGSIPSEETV KLLDMIKSGG VNLGLSENTN GSYGTSVKAP EKVEVSLPSP TPLSDPRTSG  720
WSSEASKNPF SRQSLAPDRI TQKHTAVATT NLLSQIPITV TTVRQQPTVV VPSSRHLTSI  780
SVSPYSLPQA TNVIPEKPPP LGHVQTSSDV GLTMKKNLIT ANASSVNFTG THSTLAMRGD  840
GTNYVKPVPN LSVQHEGLSN SFPQPFMPPS PTPSHSASQQ QRHQHLAQEV HYTEPPYRNP  900
GRSYPPQIEK SDHGSDNMWR VRQDHVSSSY LSQRNHNNNY NTIVGGSRQS GFYDRNNHAR  960
GEFESWSPEN SPTRNPRYAP GRNYPESRMN HGRNHRPEWS RQRGSSGHWD PGRQGNRKWH  1020
DQRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.379400.0cotyledon| flower
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates prior to flowering in the vegetative shoot apical meristem and after flowering in floral meristems.
UniprotTISSUE SPECIFICITY: Expressed in shoot apex, root apex, leaf primordia and floral buds.
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.03G211500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353490.0AC235349.1 Glycine max strain Williams 82 clone GM_WBb0092H01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006577137.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-168LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLK7KG970.0K7KG97_SOYBN; Uncharacterized protein
STRINGGLYMA03G36970.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Representative plantOGRP41211315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-143HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]