PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G130600.1.p
Common NameGLYMA_03G130600, Glyma03g28630.1, LOC100790212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 242aa    MW: 27533.2 Da    PI: 7.6605
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G130600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH41.32.7e-1362114155
                          CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                  HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                          ++ +hn+ Er RR+++N+  + Lr+llP +   + kK+s  +++ ++ +YI +Lq
  Glyma.03G130600.1.p  62 KKLSHNASERDRRKKVNDLVSSLRSLLPGP--DQTKKMSIPATVSRVLKYIPELQ 114
                          6789*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.39261113IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.64E-1262118No hitNo description
Gene3DG3DSA:4.10.280.101.2E-1262130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.4E-1562132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.3E-1062114IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.2E-1067119IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0090575Cellular ComponentRNA polymerase II transcription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MVALFSPPVF STKGWFLEEE PLSYDVSSDY SFPYQFFAPQ TQIELEIERS SAPSPEDPAM  60
VKKLSHNASE RDRRKKVNDL VSSLRSLLPG PDQTKKMSIP ATVSRVLKYI PELQHQVQAL  120
TKKKEELLCR ISKNLKGDSV NKESQRRISH HNSDFAVSTS RLNDCEAVVH ISSYEAHKAP  180
LSDILQCLEN NGLYLLNASS SETFGGRVFY NLHFQVEKTH RLESEILTEK LLSIYEKQRI  240
F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.354900.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311010.0KT031101.1 Glycine max clone HN_CCL_45 bHLH transcription factor (Glyma03g28630.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521149.11e-179PREDICTED: transcription factor ORG3-like
TrEMBLA0A0B2R7G61e-179A0A0B2R7G6_GLYSO; Transcription factor ORG2
TrEMBLI1JN791e-179I1JN79_SOYBN; BHLH transcription factor
STRINGGLYMA03G28630.11e-178(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28261129
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.12e-54bHLH family protein
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]