PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G117600.2.p
Common NameGLYMA_03G117600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 250aa    MW: 26979.6 Da    PI: 9.3218
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G117600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.42.3e-39159235177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +CqvegC++ l +akeyhrrh+vC++hskap+++v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk++
  Glyma.03G117600.2.p 159 RCQVEGCHVALVNAKEYHRRHRVCDKHSKAPKAVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSS 235
                          6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-33156221IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.906157234IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-37158236IPR004333Transcription factor, SBP-box
PfamPF031101.0E-30160233IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEFGENNMFS LNTHTKEENG NTGGNSNNNN IVNVWYSSWD ATTTTNAPHT TTAAEGYAGG  60
GHRLHHHQLY GGEGCHVQAD PHLTCLHLGK RHYFEDATNG DDANNVTSLG NRHVCGGGGA  120
GFVFAGNDKR ARGYYGGGGG GAGGGGGGGK SAPFAMVPRC QVEGCHVALV NAKEYHRRHR  180
VCDKHSKAPK AVVLGLEQRF CQQCSRFHVV SEFDDSKRSC RRRLAGHNER RRKSSHLSVT  240
RNSRQGKHN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281602331184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.267550.0leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.03G117600.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001340412.10.0LRR receptor kinase-like protein
RefseqXP_028225093.10.0squamosa promoter-binding-like protein 7
TrEMBLA0A445LAL60.0A0A445LAL6_GLYSO; Squamosa promoter-binding-like protein 7 isoform B
TrEMBLK7KEH80.0K7KEH8_SOYBN; Uncharacterized protein
STRINGGLYMA03G27195.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.14e-36squamosa promoter binding protein-like 9