PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G117500.3.p
Common NameGLYMA_03G117500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 312aa    MW: 34586.4 Da    PI: 8.7064
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G117500.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1339.6e-42196273178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  Glyma.03G117500.3.p 196 RCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKTQQ 273
                          6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-35190258IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.376194271IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.01E-38195275IPR004333Transcription factor, SBP-box
PfamPF031102.8E-31197270IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MLDYEWGNPS TIMLSGNEDS SAAGSDQTHR QIFDHYASHT LIPDHFLHAP THSTATTAAA  60
ATVDFTHHHH FTPQPHHHNQ NHMNHHHHHA FFDPRAFHGA SNTSYPPPHS MLSLDPLPHV  120
NAVGPGHGPG SGPGGLLLVP KSEDVGRPMD FVGSRIGLNL GGRTYFSSSE DDFVSRLYRR  180
SRPVEPGSTA SSNSPRCQAE GCNADLSQAK HYHRRHKVCE FHSKAATVIA AGLTQRFCQQ  240
CSRFHLLSEF DNGKRSCRKR LADHNRRRRK TQQPTQEIQK SQSSLENVAS TTFSLKFLII  300
PTLISNFCHG L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-32187270184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.446990.0flower| leaf| pod| vegetative bud
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during plant development. During pollen development, required for crosporogenesis that leads to archesporial formation and for the histogenesis of the microsporangia. During ovules development, involved in the transition to meiosis of the megaspore mother cells. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:12671094}.
UniprotTISSUE SPECIFICITY: Expressed in shoot apical region and early floral tissues. Transcripts levels increase in developing pollen sacs, and decrease in later stage of anther development. Strongly expressed in the placental region of the carpels. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:17093870}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.03G117500.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521087.10.0squamosa promoter-binding-like protein 8
RefseqXP_028225092.10.0squamosa promoter-binding-like protein 8
SwissprotQ8GXL38e-80SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLI1JMW00.0I1JMW0_SOYBN; Uncharacterized protein
STRINGGLYMA03G27180.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-77squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]