PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G080000.1.p
Common NameGLYMA_03G080000, LOC100783663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 226aa    MW: 25973 Da    PI: 9.4568
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G080000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.12.3e-131151343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         i+n  +r+  f +R+ng+lKK  E+ +LCd+ ++ ii+ ++
  Glyma.03G080000.1.p 11 ISNPVKRKAVFNQRKNGLLKKVDEITTLCDIHACAIIYTPD 51
                         99************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-16160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.287149IPR002100Transcription factor, MADS-box
CDDcd002662.34E-22283No hitNo description
SuperFamilySSF554552.35E-19393IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-7323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MARKKVNLTY ISNPVKRKAV FNQRKNGLLK KVDEITTLCD IHACAIIYTP DKPEPEVWPS  60
DQGVEDVIFR FRGVSELARS KRMFCQEKFL KRNIIKARGQ LKKLRNENRK KEIGLFMCQY  120
FLGGNHLDNA NIIDLNDIRF LVDKKLEEIT KKIEMLHVQE VTSATENRGE TMIEEKQALM  180
TNVDAMPNLN WSNDNINASG GDSMLTLEDI NVQSGWLNQF ILSKR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.03G080000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522136.11e-167agamous-like MADS-box protein AGL80
TrEMBLI1JLP71e-166I1JLP7_SOYBN; Uncharacterized protein
STRINGGLYMA03G13570.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1699628
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-40AGAMOUS-like 80