PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G007900.1.p
Common NameGLYMA_03G007900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 462aa    MW: 50323.4 Da    PI: 7.1143
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G007900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-39102161261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  Glyma.03G007900.1.p 102 PDKILQCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPIGAGRRKNKHL 161
                          7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2990159IPR003851Zinc finger, Dof-type
PfamPF027013.5E-32104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.425106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MSQTEKDPGI RLFGRKIPVP ECQIPANSGP KDACSSIMKT ELGIPSECGE NTEQQENSSD  60
SRDSKQESQH KLQENEPIVN PKPAEDDMET GSSDQDKVLK KPDKILQCPR CNSLDTKFCY  120
FNNYNVNQPR HFCKNCQRYW TAGGTMRNVP IGAGRRKNKH LASQYRHIIV TSDGIPTSRL  180
ETTDSVNAGA FLHPPISQLG ESMDSMLNLR DQRRCVDASS ISCVEYRGEP SLYGSSVTTN  240
GAQGSELSEH SPSNWLQCYP VPPWVLPYPG WNNVNSMEAV HRSSAPMCNP YNNTGPAAMQ  300
WCPTPMVAIP GMCPPSIPLQ FVPPSYWSGT QLWNAGTGTV SIGSNACLSP SSSTSNSCCS  360
GNGSPTLGKH TRDTVCTNEE KSEKCVSVPK TIRIDAPNEA SKSPIRATLA IKPDMQQFVS  420
NGDILKKNEP KEGKDRMLGA SQILEANPAA ISRAHAFQEG L*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.03G007900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939660.0BT093966.1 Soybean clone JCVI-FLGm-18A13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028223998.10.0cyclic dof factor 2-like
TrEMBLA0A0R0KD590.0A0A0R0KD59_SOYBN; Uncharacterized protein
STRINGGLYMA03G01030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.29e-61cycling DOF factor 2