PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G306200.1.p
Common NameGLYMA_02G306200, LOC100796496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 542aa    MW: 60726.6 Da    PI: 6.1054
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G306200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS458.93e-1401715411374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++ L++cA+a+s++dl +aq+l+ +l++++s +gdp+qRl ay++e+L arla s+s++yk+l+++e +   s+e l+++++++ev+P+
  Glyma.02G306200.1.p 171 LKHILIACAKAISDDDLLMAQWLMDELRQMVSVSGDPFQRLGAYMLEGLVARLAASGSSIYKSLRCKEPE---SAELLSYMHILYEVCPY 257
                          6899*****************************************************************9...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +kf+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l+ +g+rL+k+Ae+++vpfef
  Glyma.02G306200.1.p 258 FKFGYMSANGAIAEAMKDEDRVHIIDFQIGQGSQWITLIQAFAARPGGPPHIRITGIDDSTSAyaRGGGLHIVGRRLSKLAEHFKVPFEF 347
                          ***********************************************************998899999********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          ++ +a +  d++l++L v+pgEalaVn++++lh+++desvs++++rd++L+lv+slsPkvv++veqe+++n++ F+ rfle+l+yy+a+f
  Glyma.02G306200.1.p 348 HA-AAISGCDVQLHNLGVRPGEALAVNFAFMLHHMPDESVSTQNHRDRLLRLVRSLSPKVVTLVEQESNTNTAAFFPRFLETLDYYTAMF 436
                          **.88899********************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          +s++++l+re++eri+vE+++l+r++vn++aceg er+erhe l+kWr+r+ +aGF+p+pls+ ++ ++k ll++++++ yr++e++g+l
  Glyma.02G306200.1.p 437 ESIDVTLSREHKERINVEQHCLARDLVNIIACEGVERVERHEVLGKWRSRFAMAGFTPYPLSSLVNGTIKKLLENYSDR-YRLQERDGAL 525
                          *****************************************************************************66.********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +lgW++r Lv+ +aW+
  Glyma.02G306200.1.p 526 YLGWMNRDLVASCAWK 541
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.561145522IPR005202Transcription factor GRAS
PfamPF035141.0E-137171541IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQASEQHRNS SMYYQPLQQI EAYCLPQYRT LNPQLYYHDG GHGTQFSTPS SSELYCTLES  60
SSVALYNSPS TVSFSPNGSP ISQQDSQSYP PDQYHSPENT YGSPMSGSCI TDDLSSFNLK  120
HKLRELESVM LGPDSDNLDS YDSAISNGNN FVPLEMDGWK QTMVAISSKN LKHILIACAK  180
AISDDDLLMA QWLMDELRQM VSVSGDPFQR LGAYMLEGLV ARLAASGSSI YKSLRCKEPE  240
SAELLSYMHI LYEVCPYFKF GYMSANGAIA EAMKDEDRVH IIDFQIGQGS QWITLIQAFA  300
ARPGGPPHIR ITGIDDSTSA YARGGGLHIV GRRLSKLAEH FKVPFEFHAA AISGCDVQLH  360
NLGVRPGEAL AVNFAFMLHH MPDESVSTQN HRDRLLRLVR SLSPKVVTLV EQESNTNTAA  420
FFPRFLETLD YYTAMFESID VTLSREHKER INVEQHCLAR DLVNIIACEG VERVERHEVL  480
GKWRSRFAMA GFTPYPLSSL VNGTIKKLLE NYSDRYRLQE RDGALYLGWM NRDLVASCAW  540
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-591755418375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.176720.0cotyledon| hypocotyl| leaf| root| seed coat| somatic embryo| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519666.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_003519667.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_006575744.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0B2SGK30.0A0A0B2SGK3_GLYSO; Scarecrow-like transcription factor PAT1
TrEMBLI1JJQ80.0I1JJQ8_SOYBN; Uncharacterized protein
STRINGGLYMA02G47640.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein