PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G297700.1.p
Common NameGLYMA_02G297700, LOC100817120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 546aa    MW: 61468.8 Da    PI: 5.3737
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G297700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS435.44.1e-1331765452374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          +e L +cA+ v+ +d+e +++l+++l++++s +gdp+qRl ay++eAL arla+s+s++yk l+++e +    se l+ ++l++e++P+l
  Glyma.02G297700.1.p 176 KEMLCTCAKTVAVNDMETTEWLMSELRKMVSVSGDPIQRLGAYMLEALVARLASSGSTIYKVLKCKEPT---GSELLSHMHLLYEICPYL 262
                          789*****************************************************************9...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          kf+++ aN aI ea+++e++vHiiDf+i+qG+QW++L+qaLa Rp+gpp++RiTg+++++s   ++  le +g rL+ +A++ +vpfef+
  Glyma.02G297700.1.p 263 KFGYMSANGAIAEAMKEESEVHIIDFQINQGIQWVSLIQALAGRPGGPPKIRITGFDDSTSAyaREGGLEIVGARLSTLAQSYNVPFEFH 352
                          **********************************************************998899999*********************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + +  + +++el++L+++pgEa+aVn++++lh+++desv++ ++rd++++l k lsPk+v++veqe+ +n+ +F+ rf+e+++yy a+f+
  Glyma.02G297700.1.p 353 A-IRASPTEVELKDLALQPGEAIAVNFAMMLHHVPDESVDSGNHRDRLVRLAKCLSPKIVTLVEQESHTNNLPFFPRFVETMNYYLAIFE 441
                          *.5888999********************************************************************************* PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          s+++ lpre++eri+vE+++l+re+vn++aceg+er+erhe l+kWr+r+++aGF p+pl++++++++k l r + ++ y++ee++g+l+
  Glyma.02G297700.1.p 442 SIDVALPREHKERINVEQHCLAREVVNLIACEGEERVERHELLKKWRSRFTMAGFAPYPLNSFITCSIKNLQRSYRGH-YTLEERDGALC 530
                          **************************************************************************9966.*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          lgW+++ L++ +aWr
  Glyma.02G297700.1.p 531 LGWMNQVLITSCAWR 545
                          **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.669149526IPR005202Transcription factor GRAS
PfamPF035141.4E-130176545IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MQMSQKHKMS YDSSRFTSEP VQNLGSCCFL QSGNLDYYSS SDNSSHATYP SVCTFEQYCT  60
LESSTNNNLP SLNSSSTVSF SPNNSPVSKL QSKSNVLSSQ NSLELVNDSL ENESCLTLNN  120
DELRHKIREL ESALLGHDTY ILDTYDTIIP EESDSFMLEA ERWKRMMEMI SRGDLKEMLC  180
TCAKTVAVND METTEWLMSE LRKMVSVSGD PIQRLGAYML EALVARLASS GSTIYKVLKC  240
KEPTGSELLS HMHLLYEICP YLKFGYMSAN GAIAEAMKEE SEVHIIDFQI NQGIQWVSLI  300
QALAGRPGGP PKIRITGFDD STSAYAREGG LEIVGARLST LAQSYNVPFE FHAIRASPTE  360
VELKDLALQP GEAIAVNFAM MLHHVPDESV DSGNHRDRLV RLAKCLSPKI VTLVEQESHT  420
NNLPFFPRFV ETMNYYLAIF ESIDVALPRE HKERINVEQH CLAREVVNLI ACEGEERVER  480
HELLKKWRSR FTMAGFAPYP LNSFITCSIK NLQRSYRGHY TLEERDGALC LGWMNQVLIT  540
SCAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-601795458375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519619.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A0B2SHR70.0A0A0B2SHR7_GLYSO; Scarecrow-like protein 5
TrEMBLI1JJH10.0I1JJH1_SOYBN; Uncharacterized protein
STRINGGLYMA02G46730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein