PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G242100.1.p
Common NameGLYMA_02G242100, LOC100796325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 467aa    MW: 51416.8 Da    PI: 8.1689
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G242100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32276329255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Glyma.02G242100.1.p 276 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 329
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15273329IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28274329IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23276329IPR006447Myb domain, plants
PfamPF002498.7E-7277328IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MTLEGIFIEP TSTTAPDLSL HISPPTISSS SLISNHGSNN FPSRTTTLFQ QAHTELSLGR  60
NFTSETPTPT PTPTPTPHNP YYQSLNHFHH LHHHHNHNNN NNTSTSVNTT STTTTNTPLN  120
HINYGVSLLD VSSSDTLRPI KGIPVYHNRS FPFVAAMDHA RDDDNNNNKD HHHHHKMCLY  180
NNHHNMPSYH PSLSPSTAAP SPSPYFVDPM SLLNNGSTVA ACRAATATRF NGFSGDAFKS  240
SHPLHQYGVG PSEASSGFMR SRFLQKLPNK RSMRAPRMRW TSTLHARFVH AVELLGGHER  300
ATPKSVLELM DVKDLTLAHV KSHLQMYRTV KTTDKPAASS GHSDGSGEDD LSPMGSTADR  360
GGLRQFPNHR GRPEWQAQQD MDYPSTTPIL WSNSSSCGES RLRPSSNDID GLRSPILQSQ  420
TISGGHQIQE CDSTQLKNNM AGSNLKKNPS LEFTLGRPDW DGKEQA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16277331458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.47260.0root| seed coat
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G242100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518367.10.0transcription repressor KAN1 isoform X1
TrEMBLK7KAH60.0K7KAH6_SOYBN; Uncharacterized protein
STRINGGLYMA02G40930.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.17e-54G2-like family protein