PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G223700.1.p
Common NameGLYMA_02G223700, LOC100787695
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 406aa    MW: 44173.3 Da    PI: 4.9909
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G223700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21.1e-05544639
             zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         C+ +++++   +C++++ +lC +C  + H+       H++
  Glyma.02G223700.1.p  5 CDFCGDQRSLVYCRSDSACLCLSCDRNVHSAnalsrrHSR 44
                         *****************************65677777765 PP

2CCT64.62.9e-22348391144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          R +a++RYkeK+ktRkFeKk+rY+sRKa+A+ R+RvKGrFvk+ 
  Glyma.02G223700.1.p 348 RSNAVMRYKEKKKTRKFEKKVRYASRKARADVRKRVKGRFVKAG 391
                          899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.527147IPR000315B-box-type zinc finger
CDDcd000211.23E-7447No hitNo description
SMARTSM003363.0E-8447IPR000315B-box-type zinc finger
CDDcd000210.009394790No hitNo description
PfamPF062038.4E-17348390IPR010402CCT domain
PROSITE profilePS5101715.467348390IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGYLCDFCGD QRSLVYCRSD SACLCLSCDR NVHSANALSR RHSRTLVCER CNSQPAFVRS  60
VEEKISLCQN CDWLGHGTSP SSSMHKRQSI NCYSGCPSAA EFSSIWSFFL DIPSLGEACE  120
QELGLMSINE NIPPEGQNVS GSTEVTDLPS KGKSWAGTPS IPESSSEPRI LDQPPGPANE  180
CVPKLYCPGK KASGICEDDD LYDDFIMDEV DLELENYEEL FGMALSHSEE LFENGGINSL  240
FEAKDMSASA GDSHCQGAVA AEGSSAGLVN PIQPACSNAA SADSVMSTKT EPIVCFTARQ  300
SQSNISFSGV TKDSAGDYQD CGASSMLLMG EPPWCPPCPE SSLHSANRSN AVMRYKEKKK  360
TRKFEKKVRY ASRKARADVR KRVKGRFVKA GDVYDYDPLN QTRSY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.277710.0cotyledon| flower| hypocotyl| leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G223700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0688990.0HM068899.1 Glycine max CONSTANS-like zinc finger protein (COL18) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519240.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_006575398.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_014624640.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_014624644.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_028214123.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028214132.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028214141.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028214151.10.0zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-149COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A445LSC30.0A0A445LSC3_GLYSO; Zinc finger protein CONSTANS-LIKE 9 isoform A
TrEMBLI1JH980.0I1JH98_SOYBN; Uncharacterized protein
STRINGGLYMA02G38870.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-120B-box type zinc finger protein with CCT domain