PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G195700.1.p
Common NameGLYMA_02G195700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 293aa    MW: 32311.6 Da    PI: 5.7325
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G195700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.62.1e-361267560
               zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                         + +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg++kn++
  Glyma.02G195700.1.p 12 SPNCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCKKNRR 67
                         568***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.3971367IPR003851Zinc finger, Dof-type
PfamPF027015.6E-311367IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-221558IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101551IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MESGWKPEVE MSPNCPRCGS SNTKFCYYNN YSLTQPRYFC KGCRRYWTKG GSLRNVPVGG  60
GCKKNRRGNK TLLRQSIDDH NNNPLGHSYD PRIRASSASS SSSVVTDGPN IDLALVFANF  120
LNQKPNSSEG GVESSTNPDQ EQTVFDPSLE NNSRLSNTDV VGPSTLPEEL GLTGCLNLPE  180
QQPHTHSSEA NNNNNQMCYG EFNTMQTLQK DGIEQYSSHG GAMNFELPPL PGEGEASHDH  240
HMMWSNSEMM INHHAFQVTQ PPLLGLEVHD ADLLIGNWSP FDSPKDTSFS RP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G195700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150417e-90AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025983088.10.0dof zinc finger protein DOF3.5
RefseqXP_028189711.10.0dof zinc finger protein DOF3.5-like
TrEMBLA0A0R0KYP30.0A0A0R0KYP3_SOYBN; Uncharacterized protein
STRINGGLYMA02G35296.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.16e-42Dof family protein