PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G177500.1.p
Common NameGLYMA_02G177500, LOC100819941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 359aa    MW: 38349.8 Da    PI: 9.9462
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G177500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.67.4e-4374150177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqv gC++dls ak y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh lsefD++krsCr+rLa+hnerrrk+ 
  Glyma.02G177500.1.p  74 RCQVAGCKVDLSGAKAYYSRHKVCAMHSKSPTVTVAGLEQRFCQQCSRFHLLSEFDQGKRSCRKRLAGHNERRRKPP 150
                          6**************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-3568136IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.94972149IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-4073154IPR004333Transcription factor, SBP-box
PfamPF031108.0E-3375148IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGSASVTKAP PSSSSSPNSS STESLDGLKF GQKIYFEEVS VAAAAATTTQ GGNKTRGGVS  60
ASKKGRGGSV QAPRCQVAGC KVDLSGAKAY YSRHKVCAMH SKSPTVTVAG LEQRFCQQCS  120
RFHLLSEFDQ GKRSCRKRLA GHNERRRKPP PSSVLTSRYG RLSLPIFDNN GRDDGFLMEF  180
ASYPKLTLRN TLPTQRSTEP APGNHAATLT WQGGSDTPSE FFLQGSGSSG GTSFLSSKHP  240
LVESYTGVTD SNCALSLLSS QTWGSRNTAP ATSFELNNNL FNFNGTSMTQ FAVASLQAAA  300
IHQLPNATSW LYLKGVDSGN CSPERVPNHG LAQISPPLHS HVHSELDVSQ QGRRHYMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-30751481184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G177500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001354864.10.0squamosa promoter-binding-like protein 9a
SwissprotA3C0572e-58SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLK7K9670.0K7K967_SOYBN; Uncharacterized protein
STRINGGLYMA02G30670.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.16e-51squamosa promoter binding protein-like 9