PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G171300.1.p
Common NameGLYMA_02G171300, LOC100779138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 330aa    MW: 36493 Da    PI: 8.203
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G171300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.91.4e-17169223256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Glyma.02G171300.1.p 169 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 223
                          778899***********************************************98 PP

2HD-ZIP_I/II1277.9e-41169259192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +
  Glyma.02G171300.1.p 169 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-A 257
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Glyma.02G171300.1.p 258 LK 259
                          55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-17162228IPR009057Homeodomain-like
PROSITE profilePS5007117.151165225IPR001356Homeobox domain
SuperFamilySSF466898.55E-18166234IPR009057Homeodomain-like
SMARTSM003891.3E-15167229IPR001356Homeobox domain
CDDcd000863.85E-15169226No hitNo description
PfamPF000464.6E-15169223IPR001356Homeobox domain
PROSITE patternPS000270200223IPR017970Homeobox, conserved site
SMARTSM003404.5E-26225268IPR003106Leucine zipper, homeobox-associated
PfamPF021836.6E-11225259IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MELALSLGDT SKSFTFLDKA AVNLPTNKDP PGLFSLAPSF AATAAAADKR SDAAERRGFS  60
SDPPVQLDLL PFSPVLRPQQ QPPSQLRIPW LTEACGAARV LDVNLFRAAT AEDGDDGTSL  120
SSSPNSAVSP FQMDFCTRNC NAEFGGRNKR EQQEAEGRAS DDDENGSTRK KLRLSKEQSA  180
FLEESFKEHT TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD CEYLKRCCET  240
LTEENRRLQK ELQELRALKT SQPFYMQLPA TTLTMCPSCE RVATNSTTTN QTTTVNNNAS  300
QIPVELSLSK PRILPFPNGQ AQAHQIASS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167173TRKKLRL
2217225RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G171300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-103AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518045.10.0homeobox-leucine zipper protein HOX11
RefseqXP_028208911.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466652e-87HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A0R0KY170.0A0A0R0KY17_SOYBN; Uncharacterized protein
TrEMBLA0A445LQ250.0A0A445LQ25_GLYSO; Homeobox-leucine zipper protein HAT14
STRINGGLYMA02G28860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-66homeobox from Arabidopsis thaliana