PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G108600.1.p
Common NameGLYMA_02G108600, LOC100788246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 486aa    MW: 53027.1 Da    PI: 7.1832
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G108600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22e-39146205261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk++
  Glyma.02G108600.1.p 146 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNT 205
                          78999*****************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31139203IPR003851Zinc finger, Dof-type
PfamPF027014.3E-32147204IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975150204IPR003851Zinc finger, Dof-type
PROSITE patternPS013610152188IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MSEVVTKDSA IKLFGRTISL SRNNNNNNNN NEVSSSANGF SSDEPAPPED SSSSFPREVS  60
STTEHEAGRD KEPSRKELTS AQEEDEEASH QTIEEPKSPT SSSCNLENPK TPSTERETSI  120
LKSSKNGDQS DATTTSPSQD KTLKKPDKVL PCPRCNSMDT KFCYYNNYNV NQPRHFCKNC  180
QRYWTAGGTM RNVPVGAGRR KNKNTPSSLS HFRQIMVPEG LQNGSLHGAA VLTFGSDPPL  240
CDSMASVLSL AEKTTQNGFH SPNGDEYYDT VMASTLSERR DNATTSTNSR QESLDNHKSY  300
HHHHHHHHHQ GFTPQLCFPG SSSSPWPYPS NNPIMTPSAF CHPVPFYPTQ AFWGSMPPPS  360
WSVNYQSAPG SGPNSPTLGK HSRDGDILFS TDMAANNNNN TVLIPKTLRI DDPTEAAKSS  420
IWSTLGIKNE KGNSLNGGGL FKAFASKGNS DDKKNHAVMV EASPSPVLQA NPAALSRSLV  480
FHERT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.592760.0flower| hypocotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G108600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520081.10.0cyclic dof factor 1
TrEMBLK7K7M10.0K7K7M1_SOYBN; Uncharacterized protein
STRINGGLYMA02G12081.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.14e-75cycling DOF factor 3