PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G092700.1.p
Common NameGLYMA_02G092700, LOC100787357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 372aa    MW: 39921.5 Da    PI: 9.8338
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G092700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.6e-3876135261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          +++alkcprC+stntkfCyynnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk++
  Glyma.02G092700.1.p  76 PDAALKCPRCESTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRN 135
                          68899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2960125IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3278134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.38580134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MVFPSLPIYL DPPNWSQQQP NQQAGIGTNN PQIPPPLQPS PPSSVTTGIG GGDYIQGSIR  60
PGSMADRARM AKIHQPDAAL KCPRCESTNT KFCYYNNYSL SQPRHFCKTC RRYWTRGGAL  120
RSVPVGGGCR RNKRNKGNSA RSKSPMKPSA SANSSSSGCT PDHVMMTHLP TPITPTQFPF  180
LASLHHYNGD YVSGGIGSHF GAITTPLVAR NNGNNTSDVE FQIGTSSASS LGNISGGAML  240
SNNGLGDQQW RFNNLQQVQH QFPFLSTNFE PQIGVFQFGG GENNNAEPPS YAKGHGGRFN  300
NIRSKMDSIN SSVSGIVPQL NTIKLEENQG LSLSKNLLMT SSGNGVLWNN GSSGNAWSEV  360
PSFIPSPNHL L*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G092700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520022.10.0dof zinc finger protein DOF2.4 isoform X1
TrEMBLK7K7B30.0K7K7B3_SOYBN; Uncharacterized protein
STRINGGLYMA02G10250.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-36DNA binding with one finger 2.4