PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G082100.1.p
Common NameGLYMA_02G082100, LOC547624
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 632aa    MW: 69993 Da    PI: 5.8276
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G082100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix932.9e-2964147186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW++qe+laL+++r++m+ ++r+++ k+plWeevs+k++e g++r++k+Ckek+en+ k++k++keg++++++++  t+++fdql+
  Glyma.02G082100.1.p  64 RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRNAKKCKEKFENVYKYHKRTKEGRSGKSEGK--TYRFFDQLQ 147
                          8********************************************************************975544..6******98 PP

2trihelix103.61.5e-32454539187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+k ev+aLi++r+++e++++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
  Glyma.02G082100.1.p 454 RWPKMEVQALINLRTSLETKYQENGPKGPLWEEISALMRKMGYNRNAKRCKEKWENINKYFKKVKESSKKR-PEDSKTCPYFHQLEA 539
                          8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.74857121IPR017877Myb-like domain
SMARTSM007170.002861123IPR001005SANT/Myb domain
CDDcd122032.67E-2363128No hitNo description
PfamPF138374.5E-1963149No hitNo description
PROSITE profilePS500907.108447511IPR017877Myb-like domain
SMARTSM007177.0E-4451513IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-4451510IPR009057Homeodomain-like
CDDcd122038.43E-28453518No hitNo description
PfamPF138372.0E-21453540No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MLGDSAVLGT GGGGSGDAVA APPVVGGGAA ASGGAHEGGA NGGGGSNSGD DRVEEGDKSF  60
GGNRWPRQET LALLKIRSDM DVAFRDASVK GPLWEEVSRK LAELGYHRNA KKCKEKFENV  120
YKYHKRTKEG RSGKSEGKTY RFFDQLQALE NNPSIHAMQS PTPTPSKPPQ TTALLATPVS  180
IVVTTTTTPS TLVSNNATVP STNTPPLPQA ILNITPPSTL NITTPSFPSS NPTTYFPTQT  240
PNPTTNNNPP NTITPASFPN FSADLLSNSS FSSTSSEETT TMGGGGMRRK RKRKWKDFFE  300
RLMKEVIEKQ EGLQRRFLEA IEKREQERVV REEAWRMQEM QRINREREIL AQERSIAAAK  360
DAAVMTFLQK IAEHQQQEIN LEPALNNNNN SITVVPQQPV PQTTTTPTPT PQQAQTTIVP  420
EAPQPQQQIV VSNVENNKAD NNGENLTMGA SSSRWPKMEV QALINLRTSL ETKYQENGPK  480
GPLWEEISAL MRKMGYNRNA KRCKEKWENI NKYFKKVKES SKKRPEDSKT CPYFHQLEAL  540
YREKNKREGQ MKPDSMMAPL MVQPEQQWPP QTHVVPPEVT MGDAQNDPMD RRHEEVEEDE  600
ADKEIGDEDE DEDDEGSDNY EIVASKPASG E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1287292RRKRKR
2287293RRKRKRK
3288293RKRKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G082100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3724980.0AF372498.1 Glycine max GT-2 factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518601.10.0trihelix transcription factor GT-2
RefseqXP_028199761.10.0trihelix transcription factor GT-2-like
RefseqXP_028199769.10.0trihelix transcription factor GT-2-like
SwissprotQ391171e-146TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A445LL610.0A0A445LL61_GLYSO; Trihelix transcription factor GT-2 isoform A
TrEMBLK7K7300.0K7K730_SOYBN; Uncharacterized protein
STRINGGLYMA02G09060.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-80Trihelix family protein
Publications ? help Back to Top
  1. O'Grady K,Goekjian VH,Naim CJ,Nagao RT,Key JL
    The transcript abundance of GmGT-2, a new member of the GT-2 family of transcription factors from soybean, is down-regulated by light in a phytochrome-dependent manner.
    Plant Mol. Biol., 2001. 47(3): p. 367-78
    [PMID:11587508]