PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G082000.1.p
Common NameGLYMA_02G082000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 600aa    MW: 68007.4 Da    PI: 5.6242
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G082000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.19.7e-2869152186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW++qe+laL+++r +m+  +r+++lk+plWeevs+k++e g++rs+k+Ckek+en+ k+ k++ke++++++    + +++fdql+
  Glyma.02G082000.1.p  69 RWPRQETLALLKIRLDMDAVFRDSSLKGPLWEEVSRKLAELGYQRSAKKCKEKFENVYKYNKRTKENKSGKSH--GKAYKFFDQLQ 152
                          8*****************************************************************9999754..456******98 PP

2trihelix99.13.7e-31417502187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+k ev++Li++r+++e +++++  k+plWe++s++m++ g++rs+k+Ckekwen+nk++kk++e++k+r  e+s+tcpyf++lea
  Glyma.02G082000.1.p 417 RWPKAEVHDLIRLRTSLEIKYQENGPKAPLWEDISIAMQRLGYNRSAKRCKEKWENINKYFKKVRESSKER-REDSKTCPYFHELEA 502
                          8*********************************************************************8.78999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.70262126IPR017877Myb-like domain
SMARTSM007171.266128IPR001005SANT/Myb domain
PfamPF138375.0E-1868154No hitNo description
CDDcd122033.25E-2468133No hitNo description
PROSITE profilePS500906.806410474IPR017877Myb-like domain
SMARTSM007171.7414476IPR001005SANT/Myb domain
PfamPF138371.8E-20416503No hitNo description
CDDcd122031.29E-25417481No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MQLGDSSVLE ISSHTEPEMA VVSPPEEAPH EGGHNSGGGG GSDEMIGMDL DANSGEGNEG  60
NKMSFGGNRW PRQETLALLK IRLDMDAVFR DSSLKGPLWE EVSRKLAELG YQRSAKKCKE  120
KFENVYKYNK RTKENKSGKS HGKAYKFFDQ LQALENQFTV SYPPKPQPTS TLTTTNTLTS  180
DHGNKVISYV TPFPSTNPTL IPPSPQTNTN TTTTTTTTST TDPRDSSPPQ TNNNNNSVPH  240
SLPNMNAPFL TTTTSTSSST ASDEDLEERY RRKRKWKDYF RRLTRKVLLK QEEMQKKFLE  300
AMDQRERERV AQQDNWRMQE MARINREHEI LVQERSTASA KDAAVIALLQ KMYGQQNPTQ  360
HVEVEPPQQQ KQTMPQSQPP ILMPNNNFEV KKMNNGHSAT STTTTTTSPV SSSSSSRWPK  420
AEVHDLIRLR TSLEIKYQEN GPKAPLWEDI SIAMQRLGYN RSAKRCKEKW ENINKYFKKV  480
RESSKERRED SKTCPYFHEL EALYKEKGKS QNPFGMFQNM TPNETMMMEP LMVQPEQQWR  540
PPPQSLEEGI GKDNASEEYN QEKEEEVEEN GGDDDDNIEE DGDSVEDAGP NPCEIATNN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.236620.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G082000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025980789.10.0trihelix transcription factor GT-2-like
TrEMBLI1JDE90.0I1JDE9_SOYBN; Uncharacterized protein
STRINGGLYMA02G09050.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.24e-72Trihelix family protein