PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G062700.1.p
Common NameGLYMA_02G062700, LOC778095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 235aa    MW: 24405.8 Da    PI: 8.4903
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G062700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.8e-382787262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  Glyma.02G062700.1.p 27 EQENLPCPRCDSTNTKFCYYNNYNYSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 87
                         57899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.2E-332985IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-273085IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2173185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MPSSNSGESR RASKPQSSGG AAPPPPEQEN LPCPRCDSTN TKFCYYNNYN YSQPRHFCKS  60
CRRYWTHGGT LRDIPVGGGS RKNAKRSRTH HVAATSSSST SSTMTSAQEH HAHTLLAPVA  120
STHYGVLDGD VKQTSNGNGN VCGSFTSLLN NTHGSGFLAL GGFGLGHGYD DMGFGIGRSG  180
WAFPGMVDGG NIGGAVASSG LNTWQLESGE GGFVSGDCFA WPGLAISTPG NGLK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286690.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Constitutively expressed in the whole plant. {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:8718629}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G062700.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572510.0DQ857251.1 Glycine max Dof2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518090.11e-172dof zinc finger protein DOF3.4
SwissprotQ390881e-62DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLK7K6R91e-171K7K6R9_SOYBN; Uncharacterized protein
STRINGGLYMA02G06970.21e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.15e-59OBF binding protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]