PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G018900.1.p
Common NameGLYMA_02G018900, LOC100804830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 94aa    MW: 10356.7 Da    PI: 9.3337
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G018900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.13.8e-0921601554
                         HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                  HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                         +i +  ++L++l+P++ + +s K+s a +L+++++YIk+L
  Glyma.02G018900.1.p 21 QITDLVSKLQQLIPELRARRSDKVSAAKVLQETCNYIKNL 60
                         6889999********879********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.801660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.9E-92176IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-62160IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.07E-92182IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSSRRSRSRQ SGASAEITDA QITDLVSKLQ QLIPELRARR SDKVSAAKVL QETCNYIKNL  60
HREVDDLSDR LSELLANTDS NSAQAAIIRS LLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.239001e-159hypocotyl| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1417171e-104BT141717.1 Lotus japonicus clone JCVI-FLLj-9B13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519021.18e-60PREDICTED: transcription factor PRE6
RefseqXP_014507695.18e-60PREDICTED: transcription factor PRE6
SwissprotQ8GW327e-41PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A0B2PLW09e-60A0A0B2PLW0_GLYSO; Transcription factor bHLH135
TrEMBLA0A0R4J2M09e-60A0A0R4J2M0_SOYBN; Uncharacterized protein
STRINGGLYMA02G02250.12e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18771240
FabidsOGEF56734143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.13e-42bHLH family protein