PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G008600.1.p
Common NameGLYMA_02G008600, LOC100814273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 1011aa    MW: 112276 Da    PI: 6.2598
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G008600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.72.2e-40155232178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C+adls+ak+yhrrhkvCe+hska+ +lv + +qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Glyma.02G008600.1.p 155 VCQVEDCSADLSKAKDYHRRHKVCEMHSKASRALVGNAMQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNH 232
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-33149217IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18153230IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.06E-37154234IPR004333Transcription factor, SBP-box
PfamPF031103.7E-29156229IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.89E-7782894IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.209.8E-7783898IPR020683Ankyrin repeat-containing domain
CDDcd002044.94E-7784895No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1011 aa     Download sequence    Send to blast
MEAKFGAEAY HFYGVGASSD LRGVGKRSSE WDLNDWRWDG DLFIASRLNP VPADGVGVGQ  60
QFFPIGSGIP VAGGPSNSSS TSEEVDPRDP KANKEGDKKR RVIVLEDDGL NEEGGTLSLK  120
LGGHASAVVD REVGSWDGTN GKKSRVSGST SNRAVCQVED CSADLSKAKD YHRRHKVCEM  180
HSKASRALVG NAMQRFCQQC SRFHLLQEFD EGKRSCRRRL AGHNKRRRKT NHEAVPNGSS  240
LNDDQTSSYL LISLLKILSN MHSDRSDQTT DQDLLTHILR SLASQNGEQG GKNIANLLRE  300
PENLLREDGS SRKSEMMSTL FSNGSQGSPS NIRQHETVSM AKMQQQVMHA HDAGASDQQI  360
TSSIKPSMSN SPPAYSEARD STAGQIKMNN FDLNDIYIDS DDGMEDLERL PVSTNLVTSS  420
LDYPWAQQDS HQSSPPQTSG NSDSASAQSP SSSSGEAQSR TDRIVFKLFG KEPNDFPLVL  480
RAQILDWLSH SPTDMESYIR PGCIVLTIYL RQAEALWEEL CYDLTSSLNR LLDVSDDTFW  540
RNGWVHIRVQ HQMAFIFNGQ VVIDTSLPFR SNNYSKILTV SPIAVPASKR AQFSVKGVNL  600
IRPATRLMCA LEGKYLVCED DHMSMDQCSK EPDELQCVQF SCSVPVMNGR GFIEIEDQGL  660
SSSFFPFIVV EEDVCSEICT LEPLLELSET DPDIEGTGKI KAKNQAMDFI HEMGWLLHRS  720
QLKLRMVSSV DLFPLKRFKW LIEFSMDHDW CAAVRKLLNL LFDGTVNTGD HPSLYLALSE  780
MGLLHKAVRR NSKHLVELLL RYVPENISDK LGPEEKALVD GENQTFLFRP DVDGTAGLTP  840
LHIAAGKDGS EDVLDALTND PCMVGIEAWK NARDSTGSTP EDYARLRGHY AYIHLVQKKI  900
NKKQGAAHVV VEIPSNMTEN NTNKKQNELS TIFEIGKPEV RRGQGHCKLC DNRISCRTAV  960
GRSMVYRPAM LSMVAIAAVC VCVALLFKSS PEVICMFRPF RWENLDFGTS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-31147229384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.55620.0cotyledon| flower| leaf| root| seed coat| somatic embryo| stem| vegetative bud
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively during plant development. {ECO:0000269|PubMed:10524240}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G008600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518623.10.0squamosa promoter-binding-like protein 1
RefseqXP_014619605.10.0squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLI1JBB80.0I1JBB8_SOYBN; Uncharacterized protein
STRINGGLYMA02G01160.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]