PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G194200.1.p
Common NameGLYMA_01G194200, LOC100820459
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 477aa    MW: 54005.6 Da    PI: 5.4661
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G194200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3565.9e-1091024733374
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          + Lle A+av+++++++ q+l++ l+el+sp+gd+ q+la+yf++A  +r+++ ++++y++l++ ++++ + +++ + +  f+evsP+ +
  Glyma.01G194200.1.p 102 DILLETARAVADKNTTRLQQLMWMLNELSSPYGDTDQKLASYFLQAFFSRISQAGDRTYRTLASASEKTCSFESTRKTVLKFQEVSPWTT 191
                          689***********************************************************8887775554444455555********* PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                          f+h++ N aIlea+ege ++HiiD++ ++++QWp+L++aLa+R++++p+lR+T v+ ++++ ++ ++e+g r++kfA+ +gvpf+fnv++
  Glyma.01G194200.1.p 192 FGHVASNGAILEALEGEPKLHIIDISNTYCTQWPTLFEALATRNDDTPHLRLTSVVTADATAQKLMKEIGARMEKFARLMGVPFKFNVVH 281
                          *********************************************************9999***************************96 PP

                 GRAS 183 ak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealeyysal 267
                          +  +l+dl++++L++k++Eala+n+v  lh++     ++ ++rd+v++ +++l+P++v++ve+ead++ +    +F+++f e+l+++ + 
  Glyma.01G194200.1.p 282 HVgQLSDLDFSMLDIKEDEALAINCVNTLHSIA----AVGNHRDAVISSLRRLKPRIVTLVEEEADLDVGlegfEFVKGFEECLRWFRVY 367
                          656*****************************8....888899*********************99865556679*************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.yrveeesg 356
                          f++l++++pr+s+er  +Er+  gr++v++vac+ ae++er+et+++W +r++  G+++v++se++ +++++llr++  +g  + +++++
  Glyma.01G194200.1.p 368 FEALDESFPRTSNERLLLERA-AGRAVVDLVACSAAESVERRETAARWARRMHGGGLNTVAFSEEVCDDVRALLRRYR-EGwAMTQCSDA 455
                          *********************.********************************************************.66255668899 PP

                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                           ++l+Wk++p+v++SaWr
  Glyma.01G194200.1.p 456 GIFLTWKEQPVVWASAWR 473
                          999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.3274453IPR005202Transcription factor GRAS
PfamPF035142.0E-106102473IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MDTTLFRVVS SFQHQHQPDH DQSLNNSTTS SSSRSSRQQQ NYPYPQEDEE CFNFFMDEED  60
LSSSSSKHYC PYQPHPPSTT TIHHSFSPTP CDFEFSGKWA QDILLETARA VADKNTTRLQ  120
QLMWMLNELS SPYGDTDQKL ASYFLQAFFS RISQAGDRTY RTLASASEKT CSFESTRKTV  180
LKFQEVSPWT TFGHVASNGA ILEALEGEPK LHIIDISNTY CTQWPTLFEA LATRNDDTPH  240
LRLTSVVTAD ATAQKLMKEI GARMEKFARL MGVPFKFNVV HHVGQLSDLD FSMLDIKEDE  300
ALAINCVNTL HSIAAVGNHR DAVISSLRRL KPRIVTLVEE EADLDVGLEG FEFVKGFEEC  360
LRWFRVYFEA LDESFPRTSN ERLLLERAAG RAVVDLVACS AAESVERRET AARWARRMHG  420
GGLNTVAFSE EVCDDVRALL RRYREGWAMT QCSDAGIFLT WKEQPVVWAS AWRALT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3113447337375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353060.0AC235306.1 Glycine max strain Williams 82 clone GM_WBb0068C17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517347.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLI1J9E70.0I1J9E7_SOYBN; Uncharacterized protein
STRINGGLYMA01G40180.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Representative plantOGRP27551332
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein