PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G183000.1.p
Common NameGLYMA_01G183000, LOC778100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 337aa    MW: 35634.7 Da    PI: 8.5557
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G183000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.2e-3962121261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk+k+s
  Glyma.01G183000.1.p  62 ENQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKSKSS 121
                          57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2562119IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3264120IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.43266120IPR003851Zinc finger, Dof-type
PROSITE patternPS01361068104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MIQELLGGAS ASLIAGERKI SITNGGGALL LTPPTSSSPS LSPSCTTSIT TSTATATSSN  60
SENQNLRCPR CDSSNTKFCY YNNYNLTQPR HFCKTCRRYW TKGGALRNVP IGGGCRKSKS  120
SGMSNSVAKQ TATKMKAVAS ELGRSSSQGL LDQELPQTPA ILWGSPQNSQ LMALLRANQN  180
HNPNPNPSPM SIVVKGEGNL MGSHHMVAEP LLANGLLNPR TSLGFDGVGE VLPSLGLCGS  240
FWRNNQDQTQ QQNNGFALGE HQSSGVQELY HKLRSSSSSI NYCGSDNSPV FLSNMASSSS  300
SLSNILESSS VSGSEFGCWN PTLSWSDLPT TNGAYP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.226790.0epicotyl| leaf| meristem| pod
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.01G183000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0958240.0BT095824.1 Soybean clone JCVI-FLGm-19N22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517276.10.0dof zinc finger protein DOF5.1
RefseqXP_028243087.10.0dof zinc finger protein DOF5.1-like
TrEMBLA0A445M5570.0A0A445M557_GLYSO; Dof zinc finger protein DOF5.7
TrEMBLI1J9360.0I1J936_SOYBN; Uncharacterized protein
STRINGGLYMA01G38970.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-33Dof family protein