PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G150500.1.p
Common NameGLYMA_01G150500, LOC100812635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 309aa    MW: 36075.4 Da    PI: 8.4842
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G150500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix895.3e-2849130186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W++qe+++ i++r e+e+++ ++k++k+lWe vs+kmrergf+rsp+qCk+kw+nl +ryk  ++++ ++     ++cp+f++l+
  Glyma.01G150500.1.p  49 QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSAKMRERGFRRSPEQCKCKWKNLVNRYKGKETSDPEH----GKQCPFFEELH 130
                          7****************************************************************999986....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.1E-446108IPR001005SANT/Myb domain
CDDcd122037.34E-2748113No hitNo description
PfamPF138373.5E-2448131No hitNo description
PROSITE profilePS500907.60850106IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MFGGGGEDAL AARLGMMPPS LLNPASVMSG EMSPAVPAAR EERGPAQPQW SQQETREFIA  60
IRAELERDFT ASKRNKTLWE VVSAKMRERG FRRSPEQCKC KWKNLVNRYK GKETSDPEHG  120
KQCPFFEELH AVFTQRAHNM QRLLLESETR SAQTKKGVKR SSGDRSSEEL SEDDNEVEYD  180
SEEEKPSRSN TRKRKVDKVG VEKSSRASNP SNSASNSTSI QEMLKEFFQH QLSMEMQWRE  240
MMERRAHERQ LFEQEWRQSM EKLERERLMI EQAWREREEQ RRMREESRAE RRDALLTTLL  300
NKLINESN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A8e-1550120777DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516496.10.0PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLK7K3Z30.0K7K3Z3_SOYBN; Uncharacterized protein
STRINGGLYMA01G35370.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-40Trihelix family protein