PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G121000.1.p
Common NameGLYMA_01G121000, LOC100791013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 273aa    MW: 32750.9 Da    PI: 8.1135
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G121000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.81.6e-2437119186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W+ qe+++ + +r+e+++++ ++k++k+lWe +s++m+e+g++rs++qCk+kw+nl +ryk  +++e++    +++++p++++ +
  Glyma.01G121000.1.p  37 QWSIQETKEFLVIREELDQTFMETKRNKQLWEVISNRMKEKGYHRSAEQCKCKWKNLVTRYKGFETMEQEA---TRQQFPFYNEFN 119
                          7********************************************************************96...45679**99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122033.58E-213699No hitNo description
PfamPF138376.2E-2037121No hitNo description
PROSITE profilePS500907.5493894IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEGTHHLHHH HQGHQQQQQQ RVLPQNMNVD VTDRFPQWSI QETKEFLVIR EELDQTFMET  60
KRNKQLWEVI SNRMKEKGYH RSAEQCKCKW KNLVTRYKGF ETMEQEATRQ QFPFYNEFNA  120
IFTARMQRML WAEAEGGSKK NKATTQLSSD ENEESTEAGS GRKKKKAKIG SRGGDNCSGS  180
FNSLKEILEE FMRQQMQIDT QWMEAFEARE NERRLKEMEW RQAMEVLENE RIMMEERWRE  240
REEQRRIREE ARAEKRDALI TALLNKLERQ GM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-130AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516961.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804501e-69TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLI1J7E10.0I1J7E1_SOYBN; Uncharacterized protein
STRINGGLYMA01G29760.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-65Trihelix family protein