PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G079400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 166aa    MW: 18722.1 Da    PI: 4.5433
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G079400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF39.29.2e-131149341
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                         i+n ++ + tf kR+ng lK   E+ +LCd++++vii+ 
  Glyma.01G079400.1.p 11 INNPMKGKATFKKRKNGYLKEVDEITTLCDIQACVIIYT 49
                         78899999*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.97E-15164IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.362149IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-9160IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-7323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-101149IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MARNKVHYTY INNPMKGKAT FKKRKNGYLK EVDEITTLCD IQACVIIYTL DEPEPEVWPS  60
NKGMKKGDWP FHVSILCWGN NLDNENIIDY NDITLLADKK LEITKKNENF QVQEVTLAIE  120
NGGETMTEGE QALVANVAAI SNMNWSNDNN NEDDGDVIHV NIGRC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.01G079400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006591590.16e-57agamous-like MADS-box protein AGL80
RefseqXP_028186315.16e-57agamous-like MADS-box protein AGL80
TrEMBLA0A445M0941e-119A0A445M094_GLYSO; Agamous-like MADS-box protein AGL90
STRINGGLYMA01G17880.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-16M-type_MADS family protein