PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G075900.1.p
Common NameGLYMA_01G075900, LOC100808178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 288aa    MW: 32184 Da    PI: 9.8567
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G075900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71.1e-40171248178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cq+egC+adls+ak+yhrrhkvCe hska++v+++gl+qrfCqqC rfh lsefD++krsCr+rLa+hn+rrrk+q+
  Glyma.01G075900.1.p 171 RCQAEGCNADLSDAKHYHRRHKVCEYHSKAATVVAAGLTQRFCQQCNRFHLLSEFDNGKRSCRKRLADHNRRRRKTQQ 248
                          6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.5E-35166233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.163169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-38170247IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MLDYEWGNPS TIILAGNEGG TTGKPDQTRR QIFDHNFTML SNNNILQGVS HQYHHHFNPP  60
QPHQHHAFFD PRAFQSAFTT SFSPPPRSML SLNSIPPLAT PHCGLGFLLM HKPDDVMNFE  120
GSAHRLGHGP GLGLNLGGRT YFDPFNDNTV NRLYRTKTVE SVTTLSSNLP RCQAEGCNAD  180
LSDAKHYHRR HKVCEYHSKA ATVVAAGLTQ RFCQQCNRFH LLSEFDNGKR SCRKRLADHN  240
RRRRKTQQIA QEIHKSQHSL DNVARSLPES GAQSSSSSGK VAVRVTP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-31166245584squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during plant development. During pollen development, required for crosporogenesis that leads to archesporial formation and for the histogenesis of the microsporangia. During ovules development, involved in the transition to meiosis of the megaspore mother cells. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:12671094}.
UniprotTISSUE SPECIFICITY: Expressed in shoot apical region and early floral tissues. Transcripts levels increase in developing pollen sacs, and decrease in later stage of anther development. Strongly expressed in the placental region of the carpels. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:17093870}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.01G075900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-51AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014629444.10.0squamosa promoter-binding-like protein 8 isoform X2
SwissprotQ8GXL38e-65SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLK7K2H80.0K7K2H8_SOYBN; Uncharacterized protein
STRINGGLYMA01G15258.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.14e-59squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]