PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G075800.1.p
Common NameGLYMA_01G075800, LOC100806582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 345aa    MW: 37647.8 Da    PI: 9.202
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G075800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.8e-40178255178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +CqvegC+  l +ak+yhrrhkvCe+hskap+v+v g+eqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Glyma.01G075800.1.p 178 RCQVEGCHLALLNAKDYHRRHKVCEMHSKAPKVVVLGMEQRFCQQCSRFHVVSEFDNSKRSCRRRLAGHNERRRKSSH 255
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-34175240IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129176253IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-38177258IPR004333Transcription factor, SBP-box
PfamPF031106.7E-32179252IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MEFGGNMFCL NNRDQNGNTN NNGNTFAWDS WETPANSSNN NNNNNTSSRL VNAFHLPAAS  60
RVAEADGSVP ATRHEAAGLA SALMFLPQNG GGMRHRQQQQ HPYGGDGSHV HPDPHLMCLK  120
LGKRHYFEDT SGSGSGSVAA AATLGGGLVL GDKRGKGYSS GGGASVKAAG LTAVTVPRCQ  180
VEGCHLALLN AKDYHRRHKV CEMHSKAPKV VVLGMEQRFC QQCSRFHVVS EFDNSKRSCR  240
RRLAGHNERR RKSSHDSVAR NSSKGGCALS LLSSRSDSWL SPSDLSIRCS AALRELIAEN  300
RAAIMARQFV SDRDWHNHHH AVEDFKEIQP ESNYFPQQMF PQTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-291792521184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.01G075800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517942.10.0squamosa promoter-binding-like protein 7 isoform X1
RefseqXP_028232895.10.0squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ7XT427e-56SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A445M0280.0A0A445M028_GLYSO; Squamosa promoter-binding-like protein 7
TrEMBLK7K2H70.0K7K2H7_SOYBN; Uncharacterized protein
STRINGGLYMA01G15134.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-35squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]