PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G063700.6.p
Common NameGLYMA_01G063700, LOC100797372
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 484aa    MW: 54348.7 Da    PI: 7.0917
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G063700.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.47.2e-42180256177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqv gC++dls+ k+yh+rhkvC++hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  Glyma.01G063700.6.p 180 VCQVYGCNMDLSSSKDYHKRHKVCDAHSKTAKVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRRRLAGHNERRRKPQ 256
                          6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.9E-34175242IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.607178255IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.19E-39179260IPR004333Transcription factor, SBP-box
PfamPF031101.6E-31181254IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MESWSYVPEE KGYLFSDEME FSLDAFMRSR KALVEWDNKS NFVERDGFNS DREVVKSMEF  60
VDLGFPDLLQ KSFHGSLPLE TSSYELDSNN SSKRGNSSTH VIALDSSMGE EESNSKHLSS  120
LVESKTQDSS LIDLKLGRLA DCKGASSDKV EKEGFTLTSI HPTTLSKRAR TSSLPAQAPV  180
CQVYGCNMDL SSSKDYHKRH KVCDAHSKTA KVIVNGIEQR FCQQCSRFHL LVEFDDGKRS  240
CRRRLAGHNE RRRKPQFDYM TGKQHKILQS YQAGTKYLGS SLQNKPMFPF QDIFQSSILF  300
PGKHAQISQS GRVKLEEDSI YSSQLTAPIT LDQESSSCAL SLLSDQSQYL SHHAACNPLT  360
SHRVFSGICI PNRDGQISET PLRISSADKH APNESFPCNT TSKEVIKNRS AATFSNTGHA  420
LRVHHGDDIC QPSELLDVKH HFSSEHAATV DLFQLSSHLQ RVEQQRNSVL VKWENEDYCF  480
PTV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-28172254284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.119346e-73epicotyl
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO141265646e-73
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.01G063700.6.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573162.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_006573163.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_006573164.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_028231955.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_028231963.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_028231966.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A0R0L7L10.0A0A0R0L7L1_SOYBN; Uncharacterized protein
STRINGGLYMA01G08056.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-64SBP family protein