PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G049400.1.p
Common NameGLYMA_01G049400, LOC100775201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 480aa    MW: 52553.2 Da    PI: 8.3471
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G049400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.7e-39132191261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k l+cprC+s++tkfCyynny+++qPr+fCk C+ryWt+GG++rnvPvG+grrknk++
  Glyma.01G049400.1.p 132 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKHCQRYWTAGGTMRNVPVGAGRRKNKNT 191
                          78999*****************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30130189IPR003851Zinc finger, Dof-type
PfamPF027015.9E-32133190IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.733136190IPR003851Zinc finger, Dof-type
PROSITE patternPS013610138174IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MSEVVIKDSA IKLFGRTISL PRNTKNEVSP DEPAPPEDSS SSFPREVSST TEYDAGDKKP  60
SRKELTSTQE DVEASHQTLE ETKSPTSSSC NLENPKTPST ERETSILKSF KNGHQSDTTT  120
TCPSQDKTPK KPDKVLPCPR CNSMDTKFCY YNNYNVNQPR HFCKHCQRYW TAGGTMRNVP  180
VGAGRRKNKN TPSVSHFRQI MVPEGLQNGS LHGAVLTFGS DSPLCDSMAS VLSLAEKTTQ  240
NGVLNGFHSP NTNTITSNKG DEYYDTVMGS TLSEKRHNAT TSTNSHEKSL DNHKSYHHQG  300
FTPQLCFPGS SSSSPWPYPW NPTKTPSAFC NPVPFYTTQA FWGCMPPPSW SVNYQSAPSS  360
GPNSPTLGKH SRDGDILFQK PSTDMAENNN NNNTVLIPKT LRIDDPTEAA KSSIWSTLGI  420
KNEKGNSLNG GGLFKAFASK GSSDEKKNNH VMMVEASLSP VLQANPAALS RSLVFHERT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.592760.0flower| hypocotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.01G049400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573116.10.0cyclic dof factor 1
RefseqXP_028230867.10.0cyclic dof factor 1-like
TrEMBLA0A445LZ270.0A0A445LZ27_GLYSO; Cyclic dof factor 3
TrEMBLK7K1V70.0K7K1V7_SOYBN; Uncharacterized protein
STRINGGLYMA01G05960.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.13e-74cycling DOF factor 3