PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca187117G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 70aa    MW: 7942.29 Da    PI: 9.7783
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca187117G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC34.44.6e-1114701773
            NF-YC 17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrt 73
                      + e+P ar+kki+k d+d++++ +ea  l+s + +lf+  l+ r+   a e+k++t
  Gh_Sca187117G01 14 IRPEFPTARVKKIMKLDKDINKVNSEALFLVSCSTNLFLRFLAERTAQVAAEKKKKT 70
                     5679************************************9**99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.8E-171570IPR009072Histone-fold
PfamPF008085.6E-151770IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.14E-121870IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
YVPSMAEDEA VDPIRPEFPT ARVKKIMKLD KDINKVNSEA LFLVSCSTNL FLRFLAERTA  60
QVAAEKKKKT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479157.14e-40PREDICTED: DNA polymerase epsilon subunit C
TrEMBLA0A0D2PU795e-40A0A0D2PU79_G
STRINGVIT_01s0010g03550.t011e-24(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128602530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43250.12e-26nuclear factor Y, subunit C13