PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca145821G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 63aa    MW: 7294.48 Da    PI: 5.0201
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca145821G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC116.81e-361633092
            NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdfl 92
                     +kadedv+misaeaP+l++kacelfilelt+rswlhaeenkrrtl+k+diaaa+trtdifdfl
  Gh_Sca145821G01  1 MKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFL 63
                     9*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.65E-22163IPR009072Histone-fold
PfamPF008085.5E-15154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.6E-27163IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MKADEDVRMI SAEAPILFAK ACELFILELT IRSWLHAEEN KRRTLQKNDI AAAITRTDIF  60
DFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C4e-3016351113HapE
4g92_C4e-3016351113HapE
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14147RRTLQKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.98381e-104boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284041.16e-40PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1
RefseqXP_003526954.11e-39PREDICTED: nuclear transcription factor Y subunit C-1-like
RefseqXP_003602805.17e-40nuclear transcription factor Y protein
RefseqXP_004138046.18e-40PREDICTED: nuclear transcription factor Y subunit C-1-like
RefseqXP_007137908.19e-40hypothetical protein PHAVU_009G166000g
RefseqXP_008464428.18e-40PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_008798937.19e-40PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_008798939.19e-40PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_009149806.18e-40PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_010026475.16e-40PREDICTED: nuclear transcription factor Y subunit C-1-like
RefseqXP_010250693.16e-40PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X2
RefseqXP_010663766.16e-40PREDICTED: nuclear transcription factor Y subunit C-1 isoform X2
RefseqXP_010913009.19e-40PREDICTED: nuclear transcription factor Y subunit C-4-like
RefseqXP_010913010.19e-40PREDICTED: nuclear transcription factor Y subunit C-4-like
RefseqXP_011073028.19e-40PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_012854598.11e-39PREDICTED: nuclear transcription factor Y subunit C-1-like
RefseqXP_013461673.18e-40nuclear transcription factor Y protein
RefseqXP_013600104.18e-40PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_013727066.18e-40PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_014498675.19e-40PREDICTED: nuclear transcription factor Y subunit C-1
SwissprotQ9FMV52e-41NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
SwissprotQ9SMP01e-41NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA0A022Q5381e-39A0A022Q538_ERYGU; Uncharacterized protein
TrEMBLA0A067E8S61e-39A0A067E8S6_CITSI; Uncharacterized protein
TrEMBLA0A067JFC21e-39A0A067JFC2_JATCU; Uncharacterized protein
TrEMBLA0A072V2X18e-40A0A072V2X1_MEDTR; Nuclear transcription factor Y protein
TrEMBLA0A076FQ131e-39A0A076FQ13_TOBAC; CONSTANS interacting protein 2a
TrEMBLA0A078F4Z79e-40A0A078F4Z7_BRANA; BnaA06g16420D protein
TrEMBLA0A087GWB61e-39A0A087GWB6_ARAAL; Uncharacterized protein
TrEMBLA0A0A0LNK79e-40A0A0A0LNK7_CUCSA; Uncharacterized protein
TrEMBLA0A0K9PL231e-39A0A0K9PL23_Z
TrEMBLA0A0S3RG371e-39A0A0S3RG37_PHAAN; Uncharacterized protein
TrEMBLA0A0V0HLC21e-39A0A0V0HLC2_SOLCH; Putative nuclear transcription factor Y subunit C-1-like
TrEMBLA5AFH07e-40A5AFH0_VITVI; Putative uncharacterized protein
TrEMBLG7J3W18e-40G7J3W1_MEDTR; Nuclear transcription factor Y protein
TrEMBLI1KC241e-39I1KC24_SOYBN; Uncharacterized protein
TrEMBLI3SBJ91e-39I3SBJ9_LOTJA; Uncharacterized protein
TrEMBLK4BJU91e-39K4BJU9_SOLLC; Uncharacterized protein
TrEMBLM1B8B61e-39M1B8B6_SOLTU; Uncharacterized protein
TrEMBLM4DNF99e-40M4DNF9_BRARP; Uncharacterized protein
TrEMBLV7AW781e-39V7AW78_PHAVU; Uncharacterized protein
TrEMBLW8E7X79e-40W8E7X7_BRANA; BnaC08g20340D protein
STRINGBra018046.1-P3e-39(Brassica rapa)
STRINGGLYMA06G17780.13e-39(Glycine max)
STRINGPGSC0003DMT4000394703e-39(Solanum tuberosum)
STRINGSolyc03g110860.2.13e-39(Solanum lycopersicum)
STRINGfgenesh2_kg.5__1209__AT3G48590.13e-39(Arabidopsis lyrata)
STRINGAT3G48590.14e-39(Arabidopsis thaliana)
STRINGPOPTR_0012s10050.14e-39(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47828160
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.19e-43nuclear factor Y, subunit C1