PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca138215G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 103aa    MW: 11462 Da    PI: 8.2151
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca138215G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26076.54.9e-241643699
           DUF260 36 lFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                     +FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++
  Gh_Sca138215G01  1 IFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAITFLQRQVQRLQKELDAANA 64
                     7**********************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.69166IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-22163IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
IFGASNVTKL LNELLPHQRE DAVNSLAYEA EARVRDPVYG CVGAITFLQR QVQRLQKELD  60
AANADLIRYA CNDIPTGLPQ VTGTSSVQPP LTPRNRLAEF NRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4218246130LOB family transfactor Ramosa2.1
5ly0_B3e-4218246130LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016748663.11e-69PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_016748664.11e-69PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_017605768.12e-69PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML41e-41LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A1U8PEF13e-68A0A1U8PEF1_GOSHI; protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A2P5WNI84e-68A0A2P5WNI8_GOSBA; Uncharacterized protein
STRINGEOY208517e-59(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.46e-44LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]