PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca115125G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 60aa    MW: 6709.88 Da    PI: 9.7483
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca115125G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260712.4e-222602886
           DUF260 28 kkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86
                     ++fa+vhk++Gasn +k+l+++p ++r da+ +l+yeA ar+rdPvyG+vg++++lqqq
  Gh_Sca115125G01  2 AHFAAVHKVYGASNASKMLQRIPVHKRLDAVVTLCYEALARVRDPVYGCVGHLFTLQQQ 60
                     68*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.894160IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-21260IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MAHFAAVHKV YGASNASKML QRIPVHKRLD AVVTLCYEAL ARVRDPVYGC VGHLFTLQQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-204604096LOB family transfactor Ramosa2.1
5ly0_B3e-204604096LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots, roots and floral tissues, but not in stems or leaves. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489773.14e-37PREDICTED: LOB domain-containing protein 19
RefseqXP_016710129.13e-37PREDICTED: LOB domain-containing protein 19-like
RefseqXP_017614887.13e-37PREDICTED: LOB domain-containing protein 19-like
SwissprotO221324e-30LBD19_ARATH; LOB domain-containing protein 19
TrEMBLA0A0B0MXZ88e-36A0A0B0MXZ8_GOSAR; LOB domain-containing 19-like protein
TrEMBLA0A0D2SGW69e-36A0A0D2SGW6_GOSRA; Uncharacterized protein
TrEMBLA0A1U8LAF38e-36A0A1U8LAF3_GOSHI; LOB domain-containing protein 19-like
TrEMBLA0A2P5RFT19e-36A0A2P5RFT1_GOSBA; Uncharacterized protein
TrEMBLA0A2P5XPI98e-36A0A2P5XPI9_GOSBA; Uncharacterized protein
STRINGGorai.007G091600.11e-36(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM10828359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45410.11e-32LOB domain-containing protein 19