PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca004963G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family FAR1
Protein Properties Length: 221aa    MW: 25595.6 Da    PI: 8.7405
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca004963G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR184.51.7e-2656144290
             FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                      fY+eYA++vGF +r+ + ++s+r+g+i  r++ C+keg+  + + k    r++r++tr gCka++++k +k+gkw++t++ +eHnH+l+
  Gh_Sca004963G01  56 FYDEYARRVGFVMRVMSCRRSERDGRILARRLGCNKEGYCVSIRGKFGPVRKPRPSTREGCKAMIHIKFNKSGKWVITRFIKEHNHPLV 144
                      9**************************************99999998****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.6E-2456144IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MNNVPCLCVA VDLDEGVEAI ERFTRGEILA VPCEADLIVE PHEGMEFESE DAAKIFYDEY  60
ARRVGFVMRV MSCRRSERDG RILARRLGCN KEGYCVSIRG KFGPVRKPRP STREGCKAMI  120
HIKFNKSGKW VITRFIKEHN HPLVVAPREA RQTMDEKDKK IQELTVELRN KKRLCAAYQE  180
QLTAFMKIVE EHSNQLSKKV QNVVNNLKEY ESIEPQLLQQ R
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.234080.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478448.11e-151PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
RefseqXP_012478449.11e-151PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
TrEMBLA0A0B0NKK71e-155A0A0B0NKK7_G
STRINGPOPTR_0017s05820.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39182855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-115FAR1 family protein