PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G2404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 594aa    MW: 66776.3 Da    PI: 4.9521
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G2404genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3506.51.3e-154484051353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++r w+d+mllkrlk+++k     k+  ++++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  Gh_D13G2404  48 DELERRVWRDKMLLKRLKDQSKG----KDG-VDTAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 140
                  79******************998....666.9999*************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n+i++++++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww++lgl+kdqg+p+yk
  Gh_D13G2404 141 VRFDRNGPAAIAKYQADNAIPGNNDGCNL-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGTEEWWPQLGLPKDQGPPSYK 237
                  ***************************99.******************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXX.XXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedve.gkkes 290
                  kphdlkkawkv+vLtavikh+sp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++s    s++ +s ++++++ +++dve + +e+
  Gh_D13G2404 238 KPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPDSCpplSSSGGSGSLVINDCNEYDVEgVVDEP 335
                  *******************************************************************444466677****************655666 PP

                  X.XXXXXXXXXX............XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 291 kikhvqavktta............gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  +  +vq++k  +            ++++ rkrk  ps++  ++ +  + tc+  q+++se +l+f d++++++++
  Gh_D13G2404 336 N-FDVQECKPGNlnrviqqpsfpvNLDFLRKRK--PSDDINIEHR--IHTCEFLQCPYSELQLGFLDRTARDNHQ 405
                  6.99******99********9999999999997..7777766544..89************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.8E-12848295No hitNo description
Gene3DG3DSA:1.10.3180.107.8E-75170305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.24E-61174298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MMMFEEMGIC GDMDFFGAFG EKDVTAASQV EMDAAVDDDY SDEEIDVDEL ERRVWRDKML  60
LKRLKDQSKG KDGVDTAKQR QSQEQARRKK MSRAQDGILK YMLKMMEVCK AQGFVYGIIP  120
EKGKPVTGAS DNLREWWKDK VRFDRNGPAA IAKYQADNAI PGNNDGCNLI GPTPHTLQEL  180
QDTTLGSLLS ALMQHCDPPQ RRFPLEKGVP PPWWPTGTEE WWPQLGLPKD QGPPSYKKPH  240
DLKKAWKVGV LTAVIKHISP DIAKIRKLVR QSKCLQDKMT AKESATWLAI INQEEALARE  300
LYPDSCPPLS SSGGSGSLVI NDCNEYDVEG VVDEPNFDVQ ECKPGNLNRV IQQPSFPVNL  360
DFLRKRKPSD DINIEHRIHT CEFLQCPYSE LQLGFLDRTA RDNHQLTCPH RNSSAEFGGS  420
NFNINDVKPV IFPPPFAQPK PAAPSITSVS TPFDLSGLGV PEDGQKMISD LMSIYDNNVQ  480
ANKNASPIKN PVTEGQNLLQ LKTQQQQDEF FRGQGLSFFN ESNIPANNQI LPQGEAQFDR  540
LKTSNSPFET TYNNNNSFKL MFGSPFDLSS FDYNDDLQAV GVDTMPKQDV SIWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-841733052134Protein ETHYLENE INSENSITIVE 3
4zds_B1e-841733052134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1362367LRKRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.161320.0boll| ovule| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5270450.0HQ527045.1 Gossypium herbaceum clone NBRI_A2_3611 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462029.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_012462030.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D2SKP50.0A0A0D2SKP5_G
STRINGGLYMA13G03700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein