PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 163aa    MW: 18684.7 Da    PI: 10.6498
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1913genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.71.5e-131151343
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 i n+s r++t+ kR +g+lKK  E+ +LC++++  +i s++
  Gh_D13G1913 11 ITNDSARKTTYKKRSKGLLKKVREITTLCGIQAFAVINSPD 51
                 89*******************************99999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.502149IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-17161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-20395IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-7323IPR002100Transcription factor, MADS-box
CDDcd002662.38E-21386No hitNo description
PfamPF003193.6E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MSRKKIKLAY ITNDSARKTT YKKRSKGLLK KVREITTLCG IQAFAVINSP DFGSQAEVWP  60
SLEDARRLLS EFKKLPLTKQ NKNMVNQESF LEQSLAKATQ QLRKLREENR QKELKEVMFE  120
SLSGKGILQS LNAMDLDEVD LLIKQNLADI DNRVRVLTKA SRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.125960.0boll
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431018e-73AC243101.1 Gossypium arboreum clone GM203N05-jhe, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016670153.11e-115PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK33e-44AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A1U8I1R81e-113A0A1U8I1R8_GOSHI; agamous-like MADS-box protein AGL80
STRINGGorai.013G210300.11e-111(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-46AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]